SKU: 45012498718

Frizzled-5/FZD5 Fc Chimera Protein, Human

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-5/FZD5 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms C2orf31, Fz 5, hFz5, FzE5 Accession Q13467 Amino Acid Sequence Ala27 Pro167, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms C2orf31, Fz-5, hFz5, FzE5
Accession Q13467
Amino Acid Sequence

Ala27-Pro167, with C-terminal Human IgG Fc ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Sun Y. et al. (2020) FZD5 contributes to TNBC proliferation, DNA damage repair and stemness. Cell Death and Disease. 11: 1060.1/2

Background

FZD5, a member in Frizzled family, was identified to be preferentially expressed in TNBC (triple-negative breast cancer), and associated with unfavorable prognosis. Loss and gain of function studies revealed that FZD5 contributed to TNBC cell G1/S transition, DNA replication, DNA damage repair, survival, and stemness. Mechanistically, transcription factor FOXM1, which promoted BRCA1 and BIRC5 transcription, acted as a downstream effecter of FZD5 signaling. FOXM1 overexpression in FZD5-deficient/low TNBC cells induced FZD5-associated phenotype. Finally, Wnt7B, a specific ligand for FZD5, was shown to be involved in cell proliferation, DNA damage repair, and stemness. Taken together, FZD5 is a novel target for the development of therapeutic strategies to overcome chemoresistance and prevent recurrence in TNBC.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45012498718

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
A. Reid
Draper, US
★★★★★ 5
Sweet story
Format: Hardcover
This is an enjoyable, lightweight story, perfect for middle school students. The child I bought it for is from a different culture than that depicted, and for her it was a bridge-builder in terms of helping to find commonalities and differences. It was a fun experience--effortless learning, the best kind! For others, it may be useful to see themselves reflected in the young heroine, but I can't speak to whether they will find the mirror accurate. For my reader, the conflict felt real and relatable - who hasn't experienced feeling different and excluded? And she was captured beginning to end.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2021
M
M. Tanenbaum
Chelsea, US
★★★★★ 5
excellent middle-grade novel
Format: Hardcover
This story of a muslim girl in the US and her school friends and ordinary dramas is a great addition to school libraries or public libraries and also for girl readers 9-12 or so. It's wonderful that we are getting novels about people from other faiths that are aimed at mainstream readers. It is so important for kids to read books about people from other backgrounds as well as for those from those backgrounds to have books in which they see themselves reflected. Well done!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2022
G
Verified Purchase
Grayson
Alexandria, US
★★★★★ 5
Vampire Fantasy
Format: Kindle
Following Val through this adventure of trying to find her place in the world while cultists are literally trying to get her, made me feel like I was on the edge of my seat. I also love the idea that vampires/werewolves(peak at Roving Darkness and the Druids Destiny) are just living everyday life like humans. This book made me wish I was living in this world because it felt so real. Its also very sapphic
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2024
I
Verified Purchase
Issy W
Pawtucket, US
★★★★★ 4
enjoyable cozy urban fantasy
Format: Kindle
Getting kidnapped by her cult-leader grandfather and held chained for other a month is not a pleasant experience. But when Vedalia's (Vel) aunt comes and rescues her, things start to take a turn for the better. Especially when said aunt is a vampire, who is married to a witch, and they're giving her a new start at life. This story is very much a cozy urban fantasy. There is actions and threats (as her grandfather doesn't know when to give up), but not a lot of angst (not a bad thing at all in my opinion ^^). The focus of the story is very much on Vel as she adapts to life with her new found family, and makes new friends. There is romance in the story, and it's cute - they make an adorable couple. But there is a lot more going on as well. It is an enjoyable read that is well written and paced well, and I definitely appreciate the queer representation that is in the story. The main threat is wrapped up well, and I certainly would be interested in seeing more of the characters, and Vel growing more into what she has been given. Happily devoured and I look forward to reading more by her.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2024
J
Verified Purchase
Jan Richardson
Birmingham, US
★★★★★ 5
Excellent book for neurodivergent kids
Format: Paperback
This book is fantastic!! It has really helped.my kiddo to understand there is nothing "wrong" with her and shes not a "bad kid".
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products