Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 13 - Sep 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD59, His tagProduct Specification Species Human Synonyms 1F5 antigen, 20 kDa homologous restriction factor (HRF 20; HRF20), MAC inhibitory protein (MAC IP), MEM43 antigen, Membrane attack complex inhibition factor (MACIF), Membrane inhibitor of reactive lysis (MIRL), Protectin Accession P13987 Amino Acid Sequence Protein sequence(P13987, Leu26 Asn102, with C 10*His) LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGGGSHHHHHHHHHH
Product Specification
| Species | Human |
| Synonyms | 1F5 antigen, 20 kDa homologous restriction factor (HRF-20; HRF20), MAC-inhibitory protein (MAC-IP), MEM43 antigen, Membrane attack complex inhibition factor (MACIF), Membrane inhibitor of reactive lysis (MIRL), Protectin |
| Accession | P13987 |
| Amino Acid Sequence | Protein sequence(P13987, Leu26-Asn102, with C-10*His) LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:10.6kDa Actual:11, 15kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD59 glycoprotein, also known as MAC-inhibitory protein (MAC-IP), membrane inhibitor of reactive lysis (MIRL), or protectin, is a protein that in humans is encoded by the CD59 gene. CD59 attaches to host cells via a glycophosphatidylinositol (GPI) anchor. When complement activation leads to deposition of C5b678 on host cells, CD59 can prevent C9 from polymerizing and forming the complement membrane attack complex. It may also signal the cell to perform active measures such as endocytosis of the CD59-C9 complex. Viruses such as HIV, human cytomegalovirus and vaccinia incorporate host cell CD59 into their own viral envelope to prevent lysis by complement.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy