SKU: 4898290216

LILRB1/CD85j/ILT2 His Tag Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB1/CD85j/ILT2 His Tag Protein, HumanProduct Specification Species Human Accession Q8NHL6 Amino Acid Sequence Gly24 His458, with C terminal 8*His

Product Specification


Species Human
Accession Q8NHL6
Amino Acid Sequence Gly24-His458, with C-terminal 8*His GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHHHHHHHHH
Expression System HEK293
Molecular Weight 58-82kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS PH7.4
Reconstitution Reconstitute at 0.1-1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B1 (LILRB1) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85j, ILT2, LIR1, and MIR7, contains four extracellular immunoglobulin domains, and four intracellular ITIMs. It is expressed on monocytes, macrophages, DCs, eosinophils and basophils, mB cells, T cells, and natural killer (NK) cells, as well as on in vitro cultured cord blood-derived progenitor mast cells and osteoclasts. LILRB1 and HLA-I molecule interactions are dependent on the non-polymorphic α3 domain of the heavy chain and β2 microglobulin. LILRB1 additionally interacts with the UL18 molecules from human cytomegalovirus (HCMV), which is an HLA-I homolog, RIFIN molecules from Plasmodium falciparum, Dengue virus through an unidentified ligand, and the damage associated molecular pattern proteins S100A8 and S100A9. Recent studies suggest that LILRB1 on tumor cells stimulates immune responses in certain situations.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4898290216

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
EMarie
Pawtucket, US
★★★★★ 4
Well made and durable, not a toy the pups seek out
Size: 1 Pack, Style: Tug
Well made. Thought our staffies would love since they live tugging with each other. Sadly not something they seek out. We love ALL the benebone chews though!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
S
Verified Purchase
Srp
Birmingham, US
★★★★★ 5
Durable fun enrichment toy
Size: 1 Pack, Style: Pawbler
I had been wanting to buy one of these kinds of toys for some time but thought that the other brands I had seen were too pricey so this was a great compromise for the price. My 5 yr old Portuguese water dog loves it. He spent 25 min playing with it the first day. The trick is to find a treat that is just big enough where it doesn’t fall out right away so it makes it challenging and fun for them. He has been chewing on it a lot for a week and it has not broken or shown signs of damage. One thing to note is that there is a small hole on the bottom of the toy so you cannot freeze liquids in it without covering the hole in some way so that would be my only complaint. Besides that it’s a great toy that keeps him busy and happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2025
M
Verified Purchase
Myles Long
Los Angeles, US
★★★★★ 3
Dog doesn’t care for it
Size: 1 Pack, Style: Bone
Hard to review product for its durability because my dog has never chewed it once. Doesn’t care about it at all. The bone feels rugged but smells like playdoh. It’s sat on the floor for over a month untouched.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
S
Verified Purchase
Sunshine89436
New York, US
★★★★★ 1
Pawbler FAIL: First time our dog bit the ball, it popped open and dumped all the kibble.
Size: 1 Pack, Style: Pawbler
I would not recommend! We have a 48# dog and within minutes of giving it to him, the Pawbler was open and all of the kibble was in a pile on the ground. I had washed and dried the Pawbler, added kibble, and tightened the lid as tight as possible. Imagine my surprise when, within minutes of giving it to him, the lid was off and all the kibble was on the ground. I thought it was a fluke so then I made an extra effort to make sure the lid was super tight...and the same thing happened. This time there was no food inside so he started chewing on the two parts. Within minutes of that, he'd chewed/damaged the rubber on both the body and the lid. I took it away as I didn't want him to destroy/eat any of the rubber bits. I was surprised he could even get the Pawbler in his mouth. It's heavy and he is a medium sized dog. He has the Benebone Bone, the WestPaw bone, the WestPaw ring that he chews on all of the time and none of those are showing any type of wear so to see this opened/chewed within 15 minutes makes me think this was defective. I am returning and hoping for a refund. DO NOT BUY! Poor value for the money. Not durable. Not chew resistant.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
L
Verified Purchase
lesserof2weevils
Natrona Heights, US
★★★★★ 5
Just what I was looking for to slow my large dog while eating
Size: 1 Pack, Style: Pawbler, Size: 1 Pack, Style: Pawbler
I needed something for my 50-pound dog to slow down her eating. The usual slow-feeder bowls and mats weren't really slowing her down much and I wanted her to have to think a little bit. She's not smart enough for puzzles though. So I got this kibble dispensing toy. My dog is not a chewer so I don't have to worry about her destroying it. LOVE: holds a little more than a cup of kibble, dispenses different sized kibbles, heavy weight so it wobbled around a lot without going too far away, QUIET- I couldn't bear the noise of hard plastic dispensers clacking around and this one is very quiet on our hardwood floors, kept the dog busy for at least 20 minutes. It's really all I was hoping it would be. And, well, as you can see in the video, the cat is happy about it too... As with all of these dispensers, there will be a couple of kibbles left inside that are hard to get out. But that gave my dog something to do overnight. She spent a long time getting that last kibble out. The slight scent they add to the natural rubber is not a problem at all. This dispenser is absolutely worth the money, it's going to last us a very, very long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 17, 2025

recommand products