Pay in installments of $51.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 23 - Sep 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Frizzled-5/FZD5 His Tag Protein, HumanProduct Specification Species Human Synonyms Frizzled 5, FZD5, C2orf3, Fz 5, hFz5, FzE5 Accession Q13467 Amino Acid Sequence Ala27 Pro167, with C terminal 8*His ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | Frizzled-5, FZD5, C2orf3, Fz-5, hFz5, FzE5 |
| Accession | Q13467 |
| Amino Acid Sequence | Ala27-Pro167, with C-terminal 8*His ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 25-33kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Sun Y. et al. (2020) FZD5 contributes to TNBC proliferation, DNA damage repair and stemness. Cell Death and Disease. 11: 1060. |
Background
FZD5, a member in Frizzled family, was identified to be preferentially expressed in TNBC (triple-negative breast cancer), and associated with unfavorable prognosis. Loss and gain of function studies revealed that FZD5 contributed to TNBC cell G1/S transition, DNA replication, DNA damage repair, survival, and stemness. Mechanistically, transcription factor FOXM1, which promoted BRCA1 and BIRC5 transcription, acted as a downstream effecter of FZD5 signaling. FOXM1 overexpression in FZD5-deficient/low TNBC cells induced FZD5-associated phenotype. Finally, Wnt7B, a specific ligand for FZD5, was shown to be involved in cell proliferation, DNA damage repair, and stemness. Taken together, FZD5 is a novel target for the development of therapeutic strategies to overcome chemoresistance and prevent recurrence in TNBC.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 15 reviews
Sort
Product Reviews
★★★★★ 4
Beautiful
Color: All black
Having never previously owned a self-winding watch, and because the wristband did require some link-removal adjustment, I did hold off on wearing it for a few days until I could schedule an appointment with my jeweler to have the day/date setting and band-adjustment done. But a major part of my reason for doing so was my strong impression upon receipt of the watch that this was a very good choice. It is a very beautiful watch to look at, though compact and not overly bulky like many chronograph-style watches, its' heft conveyed a sense of a very solid, well designed and constructed watch. Since having the setting and adjustments done, I have been extremely pleased with how accurately it keeps time. In short, I LOVE this watch. I will also note this. Though my jeweler retails various high-end, and much more expensive watches, he was clearly impressed with the look and feel of this watch, and even made explicit comment about what a beautiful watch he felt it was. That said, I do have a quibble. The writing of the accompanying instruction booklet was riddled with English grammatical errors which were quite frustrating, and contributed to my reason for opting to have my jeweler complete the settings and adjustment. Also, when I contacted OLEV online to solicit guidance on how to expedite registering the purchase for warranty purposes, I received an email auto response saying that any Amazon purchase would require customer service and other guidance through the seller. Since my assumption upon Amazon purchase was that I WAS purchasing from OLEV as the seller, this remains a source of confusion which I yet need to resolve.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2024
★★★★★ 1
Doesn’t keep accurate time
Color: All black
I bought this for my husband because it said that it self winds but my husband noticed that it didn’t work within the first few days so I thought maybe it was defective so I purchased another one in exchange for the first one but the second one had the same issue. Don’t waste your money on this, it doesn’t work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025
★★★★★ 3
Substandard,always donated of time when it works.it had be set on a daily
Color: Black
Stops frequently,sometimes have to give a few days for the clock to start functioning sgain
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
★★★★★ 5
Awesome watch highly recommend
Color: All black, Color: All black
My husband bought me this brand of watch for my birthday and it’s so awesome. It looks blingy but not in a bad way. Kinda looks like a Rolex. No battery.I bought him a one and he loves it .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 22, 2025
★★★★★ 5
Solid Trifold Wallet
Color: Two Tone - Cobalt Blue, Color: Two Tone - Cobalt Blue
This wallet is really nice. The stitching looks great and the materials appear to be solid. It’s exactly what I was looking for. It’s a touch smaller than my previous wallet, but that’s not a bad thing as they’re very close. It opens easily and folds back together with no problems. I would definitely recommend this to anyone looking for a solid trifold.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
recommand products
Livex Home Basics 2 Light BN Chain Hang/Ceiling Mount - C185-4393-91
188.96
Salvatore Ferragamo SF3015-216 53mm
149.10
Livex Milania 5 Light Bronze Lantern/Ceiling Mount - C185-4665-07
214.60
Livex Westfield 4 Light Brushed Nickel Chandelier - C185-4724-91
277.83
Livex Heritage 5 Light Black Chandelier - C185-4465-04
151.38