SKU: 54334243887

IL-3 Rα/CD123 Fc Chimera Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-3 Rα/CD123 Fc Chimera Protein, MouseProduct Specification Species Mouse Accession P26952 1 Amino Acid Sequence Ser17 Lys331, with C terminal Human IgG1 Fc

Product Specification


Species Mouse
Accession P26952-1
Amino Acid Sequence Ser17-Lys331, with C-terminal Human IgG1 Fc SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 80-91kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Interleukin 3 receptor alpha (low affinity) (IL3RA), also known as CD123 (Cluster of Differentiation 123) is a 45-62kDa glycoprotein member of the hematopoietin receptor superfamily. This protein associates with a beta subunit common to the receptors for IL-5 and granulocyte-macrophage colony-stimulating factor (GM-CSF) to form a high-affinity receptor for IL-3. The interleukin-3 receptor α chain (CD123) has been identified as a potential immunotherapeutic target because it is overexpressed in AML compared with normal hematopoietic stem cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54334243887

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Grammar Guru
Natrona Heights, US
★★★★★ 5
Very nice kit: Beware it is NOT heavy duty plumbing pipe though!
Size: side table leg
I want to give this kit a high rating, but I need to address the "truth in advertising" bit since there may be an important disconnect between what you think you are getting and what actually comes in the box. Black plumbing used for shelving or table legs is part of an important niche in interior design. I like the industrial loft look myself and have a variety of glass, steel, and masonry elements in my home. This kit fits that look and provides plenty of "strength" for most domestic uses, like shelves or coffee tables. But they are NOT "industrial pipe" or "maximum durability pipe." Note the phrase "cast iron finish feet," which together with the other claims might lead you to think these are cast plumbing fittings. They are NOT! The feet and flanges feel like electrical conduit fittings, and the pipe sections are likely aluminum. They might be electrical or they might be multi-use, lightweight pipe. While all this might lead you to think that you're getting a truly retro, heavy-duty pipe kit made of black plumbing pipe, you are not. But, does it matter? Depends. I find the lighter pipe's smooth finish a nice "tone-down" from the rough plumbing look. All together, this kit provides plenty of strength for most furniture and the rustic pipe look, but with a nicer, lighter finish. To me that is a plus--this is a very nice kit and costs less that if you'd pieced it together from real plumbing parts (I priced it out to compare), and looks retro but cleaner. I knew what to expect because while I got this kit free on Vine, I had purchased a nearly identical kit from another seller last year. So, I'm giving it 5 stars for what it actually is and for the price, JUST BE AWARE THE NARRATIVE IS MISLEADING. Which is unfortunate because just like some people might want the heavier pipe, I'm betting more would be attracted to the look with a cleaner, lighter feel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
C
Verified Purchase
César Guzmán
Charlottesville, US
★★★★★ 5
Libro de referencia
Format: Paperback
Execelente libros de referencia.!. El médico de la familia está encantado.!. Muy recomendable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
A
Verified Purchase
Alfred
Bozeman, US
★★★★★ 5
item as describes, fast shipping
Format: Paperback
great seller fast shipping
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2021
J
John A. Sandoval
Houston, US
★★★★★ 5
Pocketable Backup
Format: Paperback
OK... No computer, No Cell Service, No Electricity, No WiFi, No Radio, Oh My God... No Kindle... RATS! Let me see... There it is... My Emergency & Critical Care Pocket Guide... YEP! Even stagnating in the bottom of your bag its reassuring to have a backup...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2023
A
Verified Purchase
Alison R. Mutton
Draper, US
★★★★★ 4
Great info TINY BOOK
Format: Paperback
There’s small, and then there’s this book. It’s true that this is a pocket size book. Look at the dimensions and then imagine 6pt font. Giving it four stars because info is great- succinct, useful, and up to date! But taking away one star because it should come with a magnifying lens.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2022

recommand products