SKU: 54585152699

LILRB4/CD85k/ILT3 Fc Chimera Protein, Mouse

Sale price$279.00 Regular price$310.00
Save 10%

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB4/CD85k/ILT3 Fc Chimera Protein, MouseProduct Specification Species Mouse Accession Q64281 1 Amino Acid Sequence Gly24 Lys238, with C terminal Human IgG Fc

Product Specification


Species Mouse
Accession Q64281-1
Amino Acid Sequence Gly24-Lys238, with C-terminal Human IgG Fc GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 65-80kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4) is a member of leukocyte Ig-like receptors (LILRs). LILRB4 is encoded in the leukocyte receptor cluster, which is on human chromosome 19q13.4. The structure and function of LILRs are similar to those of other leukocyte receptor cluster receptors, such as killer cell immunoglobulin-like receptors. Leukocyte immunoglobulin-like receptor (LILRB4) is a kind of inhibitory receptor that plays a key role in immune checkpoint pathways. Inhibitory receptors also participate in achieving balance between activating and inhibitory actions to ensure immune responses to pathogens in the immune system. However, they not only protect the host from autoimmune responses, but also preserve peripheral tolerance. LILRB4 also regulates immune responses, and its role in regulating immune responses is mostly controlled by its ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54585152699

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brandon
West Palm Beach, US
★★★★★ 5
Great not only for TV Backlighting, but shelf lighting too!
Color: Black, Color: Black
Right off the bat, these light bars are vibrant, colorful, and have a great variety of different colors and patterns. However, I used them for a little bit of a different purpose than what they were created for... I had previously purchased the TV backlight strips from Govee, and wanted to find lighting for my shelves within the Govee ecosystem. Traditional light strips wouldn't really work unless I spliced them, which I wanted to avoid. Enter these light bars. I bought 2 sets of them, and thanks to the (quite strong) mounting options, was able to mount and angle these lights downwards to create a really cool effect over my displays. I wasn't sure how well it was going to work, but the end results speak for themselves. It looks terrific when used in this role. The cables are very long and manageable too, I was able to run them down the support beams of the shelves with some mounting clips without issue. The only negative comes down to the app itself. It's a bit overwhelming and confusing to use at first, but once you get the basic functions figured out, there's little issue. Still, I feel the user experience could be improved on the app. For example, I had to go in and create my own shortcut function to turn on all my lights at once, then make a separate one to turn them all off at once, as opposed to there being a single master on/off button in the app. It's small things that can make the app tedious to work with. Regardless, I feel that overall Govee continuous to knock it out of the park. The lights are bright, customizable, and add a ton of ambience to the room. I hope Govee continues to expand on their different room lighting options and keep the level of quality they are putting out now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2024
D
Verified Purchase
Downsize to Upsize
Carnegie, US
★★★★★ 5
This vacuum is totally worth the extra money! I LOVE MY YELLOW VAC!
Configuration: Vacuum
Don't hesitate to spend a few more dollars on this vacuum, because you won't be sorry over time. I had done extensive research on purchasing my next vacuum when I came across this model. A friend owns one of the dark green limited edition models and had great things to say about it. I tried hers out and that was that. I loved it. She also bought the floor attachment for wood or flat surface flooring that is already included with this model. I loved that attachment when I tried hers out. It glides across the floor and sucks everything up in it’s path. The Calima had everything I wanted in one package and I really loved the cheerful yellow color. The only thing I didn't like was the price of course. However, in this case I do believe you get what you pay for. Luckily, I was able to get an Amazon Warehouse like new Calima with the floor attachment for ever so slightly more than my friend’s vac plus the extra floor attachment would've cost me. YES!!! In my 16 years married life, I have bought and used a Panasonic, a Dyson and most recently a Sears Progressive (discontinued red model). Their life span has been 4-6 years each. I vowed this time to do some research up front, so I can stop my side job of buying new vacuum cleaners. I found I loved canister vacs thanks to the Progressive, so that was my number one priority. Proven longevity was the next priority. When my vac arrived, I immeditely took it out of the box and started vacuuming away. I have family members with allergies and one with allergies and asthma. My old vacuums never did the cleaning job of this little, lightweight yellow sunshine! I enjoy vacuuming again. It is so quiet that every time I use it, my daughter comments on it. It turns on a dime and is so easy to maneuver. The cord is a perfect length and winds up in a snap. I do like the digital features (that can be touched with your toes-no need to bend down) of changing the suction power. I considered other models with the manual dial and even saw one at Bed Bath and Beyond. It wasn't difficult, but the digital is better in my opinion. Compartments open and close with such ease unlike my Progressive, which I had to wrench open every time I needed to change the bag or get an attachment out. I actually broke the clasp off that allows you to change the bag within months of first getting the Progressive. The Progressive and my other vacs for that matter, were all made of cheap plastic. The Miele surpasses all of my other vacs by leaps and bounds! This company makes great vacuums! Thank you Miele and thank you Amazon!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 25, 2016
A
Verified Purchase
artgirl
Dallas, US
★★★★★ 5
It will change your mind about vacuuming
Configuration: Vacuum
I have Persian carpets, hardwood floors, brick, and tile and this vacuum works well on all of them. I also have short haired dogs and cats and live in the woods so there is a lot to vacuum up here. I have always had Kenmore canister vacuums that lasted forever and I wanted to get a vacuum cleaner that I wouldn't have to replace every few years so spent the extra money to hopefully get what they promise in that regard. I also spent the extra money on this C3 model because it is made in Germany. The body is heavy plastic but lightweight and has a great little rubber bumper around it so it won't mark your walls or break the plastic when you crash into something. The accessories are well made with no strange plastic seams that catch dirt. The hose and tube are made of heavy materials. I have to carry the canister up three different types of stairs including a narrow spiral staircase and it is very easy to do this. The body is slim enough so that it isn't awkward to carry up stairs while holding the hose and tube too. The machine is well designed, something I look for in everything I purchase. It is easy to change speeds, and turn on and off with your foot so you don't have to bend over everytime you want to turn it off or change the speed. The retractable cord is super nice, and something I was used to with the Kenmore. It keeps the cord safe from nicks and also makes it easier to transport and store. A couple of things I miss from my old Kenmore that I didn't get on this model was the on/off switch on the handle, the ability to go from floor to carpet with the beater brush, and 360 degree swivel hose at the attachment to the canister. This machine does come with the parquet twister attachment, which I read from many reviews was a great tool and can agree wholly that it is, and you can certainly leave it on to vacuum your carpets, but the turbo brush which comes with it too, is a much better cleaning tool for low pile rugs. So I vacuum all of my non-carpeted areas first, then switch the tool and go back and vacuum the rugs. It is a bit of a pain but not terrible. The biggest issue is that you have to carry the extra floor tool with you when you climb the stairs holding the vacuum. Again, not really terrible just a bit of a pain. I have had no issues with the turbo brush getting clogged with hair, but then I have short haired pets. I did choose to get the complete mainly because the canister holds the other attachments (crevice, upholstery, and wall brushes) inside making it easy to transport and less likely to lose the tools. The variable speed motor is soooo much quieter than any vacuum I've ever owned. My pets don't freak out when I vacuum now. The turbo tool has a switch on it which allows the suction to be reduced if you are pulling the rug off the floor. There is also a cool little metal strip down the back of the handle to discharge static electricity. You just have to keep your hand on it while you vacuum. This is a good example of thoughtful design. Because I was replacing a nearly defunct vacuum cleaner I was a vacuuming maniac for the first week I had the Miele. My children thought I had lost my mind and wondered how I could possibly be so excited about a vacuum cleaner...it was a change from my focus on other things, like riding bikes and stuff like that. But my house had become a dust bomb and after vacuuming one rug and watching the dull red change to bright red with a beautiful pattern that I guess I had gotten used to not seeing anymore...I started vacuuming everything in sight (that you could vacuum of course). Almost everything returned to its original color and I filled the vacuum cleaner bag quickly. I also love that the bag and filters keep the dust from reentering the house...so you aren't just moving it around to vacuum up again next week. And probably, most of all, even above the excellent job the machine does on removing dirt from carpets and upholstery, cleaning floors (the parquet twister is awesome for getting right up next to the baseboard at weird angles), is the yellow color. How can you not like vacuuming with a bright yellow vacuum?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2017
S
Verified Purchase
SoManyBooks
Pawtucket, US
★★★★★ 5
Great Vacuum
Configuration: Vacuum
I've had my vacuum for several months now. It is fantastic on hardwood floors and does a great job on furniture and stairs. The vacuum is very lightweight and quiet, making it easy to use in our two story, open plan house. Previously, I would get dirty looks from my husband if I tried to run the vacuum upstairs while he was watching television in the living area. I first purchased a Miele C1 series vacuum last year to replace my upstairs vacuum. I love that vacuum, but it has limitations as far as doing area rugs and carpet. My previous vacuums have all been Kenmore canister vacuums, and that was the only brand I would buy. I gave the Miele C1 a chance when Amazon had it at a special price. I then purchased this model, the C3, after several months because the vacuum I used downstairs started having issues. This vacuum is so lightweight and easy to carry up and down stairs that I probably should have splurged on the C3 model to begin with, as I almost always end up carrying the C3 upstairs to do the carpet in the bedroom anyway. My previous Kenmore canister vacs were very heavy and were almost impossible for me to carry safely on the stairs. While the C1 has attachments that are on a very poorly designed holder that is supposed to clip on the hose (doesn't stay there), this model has attachments inside the canister making them much more accessible and safe from being lost. My biggest complaint about this vacuum is the power brush. I have 6 cats - 3 long-haired rescues and 3 Maine Coon cats. If you are familiar with Maine Coon breed, you know they are all about fur, lots and lots of fur. We have to do a lot of brushing in our house, and our vacuums have to work hard. I discovered that the power brush is quickly overpowered with cat fur sticking on the roller brush, and I need to take small scissors after every use on a carpet and remove all the fur before the next use. It is a tedious chore and I can't believe a vacuum at this price point doesn't have a better power brush design. It does a good job cleaning the carpets, but you do have to keep after the cleaning of the brush roller. I did not have to do that with my Kenmore turbo brush. Thankfully, we only have 2 carpeted rooms in our house, and a few area rugs, so mostly I am vacuuming hardwood and it does a fantastic job on that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2019
Y
Verified Purchase
Yobe
Carnegie, US
★★★★★ 5
Best cleaning Investment you can make
Configuration: Vacuum
I have Dyson to thank for this purchase. I wanted a quiet, light, high quality vacuum that was reputable and highly rated. I had the Dyson V8 which was only really useful in the high settings, aka 7 min run time. Unless you have the patience going over the same area in the low setting. I found this vacuum through many good reviews, recommendations and a feature on a USA today article. I was hesitant spending that much money on a vacuum but after seeing how much I cleaned with a quiet vacuum in the Dyson V8 ( which I ended up returning), I made the plunge. Being able to pay the 5 installment payments on Amazon really helped make the purchase easier as well 😬. Things I really liked about the Vacuum: Its quiet. Coming from an old upright, I'm surprised how I can vacuum at midnight and not worry about the noise. Its light. You're just using the light hose while the unit rolls behind you. Makes vacuuming blinds super easy. The Dyson V8 was a chore at this. The whole unit itself is really light too, where I notice I vacuum my truck more than usual now days. Its powerful. Don't let the low sound fool you, I compared this with my Old Eureka upright vacuum and couldn't believe the suction was the same! Things I would like improved: Distinguishing Buttons for the bottom Power and Cord retract. I put blue painters tape on the cord retract button to make it quickly identifiable. More modern Hardwood floor brush. Maybe one like the Dyson soft rolling brush? Better Bag Fully indicator. Indicator basically throws you off because it goes by the resistance of the suction. So when you're vacuuming floors to even using the small brush attachment, it keeps going wild. Other than those small gripes, I REALLY LOVE THIS VACUUM! While cordless vacuums seems to be the trend now days, I prefer the stable reliable power of the cord. Having the retractable cord button really helps too. And although I like how bagless vacuums let you monitor how much dirt you're sucking up, the clean up of bagged vacuums are a lot less messier. But to each their own. I highly recommend this Unit!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2018

recommand products