SKU: 55353768097

Rabbit IgG lambda, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 20 - Sep 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rabbit IgG lambda, his tagProduct Specification Species Rabbit Amino Acid Sequence Protein sequence (with C 10*His) QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 0 kDa Observed MW: 17. 0 kDa Purity 95% by SDS PAGE Tag with C 10*His Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered solution of 0. 2M PBS,

Product Specification


Species Rabbit
Amino Acid Sequence

Protein sequence (with C-10*His) QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.0 kDa Observed MW: 17.0 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Lambda light chains are one of the two classes of light chains present on mammalian immunoglobulins. They are found in combination with kappa light chains. These chains are usually present in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55353768097

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Houston, US
★★★★★ 5
Moisturizing Gloves That Actually Work
Over the years, I have tried so many different types of gloves to alleviate my dry skin. Since it especially bad on my hands I have tried everything. Of all the gloves I have purchased, this pair is head and shoulders above all the others. The first night I used these I could not believe the difference! It was astonishing. My hands were soft and supple for the first time in my life, and they stayed that way for most of the day. The moisturizing aspects of leaving humectants on one's skin for prolonged periods is really a game changer. They fit perfectly and can be pulled on with ease. The crazy bonus is that I was still able to use my phone once I was wearing them. That has never been the case with any of the other gloves I've used. If you have dry skin on your hands, you must try these. One night of use and you will be sold!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2026
A
Verified Purchase
Abbylynn
Lexington, US
★★★★★ 4
A bit small for one size fits all
Purchased these for my husband who has pretty severe dry skin in the winter. The gloves are great but they are a bit small. My husband doesn’t have very large hands (cadet size golfing gloves) & this hardly reaches his wrist so one size fits most is a bit of a stretch. However, these do the job & he likes them. We appreciate the packaging doubles as a reusable pouch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2024
C
Verified Purchase
Cassidy
Cuba, US
★★★★★ 2
Awful
I love this brand & expected more, especially for the price. the gloves are super bulky and uncomfortable. they’re hard to get on and off and have a strange feeling when on because of the gel lining. they also smell odd. i wore them so about a week with several different creams/balms/lotions etc. i woke up with them off multiple times which makes me know that i was uncomfortable in them during my sleep. they also caused a weird breakout on my hands up to my wrists that took over a week to go away with the help of cortisone. it was like hives but more rash like. i didn’t bother attempting to return them and decided to throw them out. waste of money, time & ended up with a rash at the end. they did make my hands softer and helped with my cracked skin but at what cost?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 20, 2023
J
Verified Purchase
Juztme
Carnegie, US
★★★★★ 3
Update - Stick to your hands
UPDATED - I am SO impressed with the seller!! They read my review and gave me a full refund even though I no longer had the gloves to return. At this point I would suggest that you aren't taking a big risk to give these gloves a try, a lot of people obviously love them, and if you don't you can certainly get your money back. Many thanks to the excellent seller! __________________________________________ I bought these because it seemed like there were a lot of good reviews. I hated these! I don't understand why anyone liked them... they are lined with thick sticky gel. You know those gel like sticky toys that kids toss at a wall and it sticks? Or do you recall the sticky, gummy hands that you could toss and they would pick up a piece of paper or something? The lining of these gloves make me think of those toys. So my experience is that they are very difficult to get on and once they're on they really bugged me after awhile I need to get them off, but they're very difficult to get off without turning the gloves inside out. ...then you have to try get them turned back to right side out... in the end I tried them and then thought I would try them one more time but they were such a pain in the rear that I ended up tossing them in the trash because I waited too long to be able to return them. One of my saddest purchases from Amazon!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2023
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Hallelujah!
My hands were so dry and cracked until I got these babies. I didn't realize what I was getting myself into and was surprised when they were lined with some kind of silicone. Night one, I lathered my hands with whatever lotion I had laying around and went to bed. Now, these gloves are not super comfy because they're so thick, but not so bad that I won't use them. Anyway, wore them several hours and took them off in the middle of the night (they recommend at least 20-30 minutes). In the morning, my hands were baby soft. No cracks. No dryness in sight. AND it lasted all day. I did it the night after and I have not had dry hands for nearly 2 weeks! It's insane. I'm SO happy. Definitely worth it as a little treat yourself.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2023

recommand products