Pay in installments of $60.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
C1qR1/CD93 His Tag Protein, HumanProduct Specification Species Human Synonyms C1q MBL SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix remodeling associated protein 4 Accession Q9NPY3 Amino Acid Sequence Thr22 Lys580, with C terminal 8*His
Product Specification
| Species | Human |
| Synonyms | C1q/MBL/SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4 |
| Accession | Q9NPY3 |
| Amino Acid Sequence | Thr22-Lys580, with C-terminal 8*His TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 88-95kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Greenlee-Wacker M C. et al. (2011) Membrane-Associated CD93 Regulates Leukocyte Migration and C1q-Hemolytic Activity during Murine Peritonitis. J. Immunol. 187: 3353-3361. 2、Nepomuceno R R. et al. (1997) cDNA cloning and primary structure analysis of C1qRp, the human C1q/MBL/SPA receptor that mediates enhanced phagocytosis in vitro. Immunity. 6: 119-129. 3、Nepomuceno R R. et al. (1998) C1qRp, the C1q receptor that enhances phagocytosis, is detected specifically in human cells of myeloid lineage, endothelial cells, and platelets. J. Immunol. 160: 1929-1935. |
Background
Complement component 1q (C1q) receptor 1 (C1qR1, also known as C1qRp, or cluster of differentiation 93-CD93) is a 126-kDa type 1 transmembrane glycoprotein expressed in endothelial and hematopoietic cells, and responsible for C1q-induced phagocytosis. CD93 contains one C-type lectin domain and five EGF-like domains. Mature human CD93 consists of a 557 amino acid (aa) extracellular domain (ECD) with one C‑type lectin domain, four tandem EGF‑like domains, and a mucin‑like domain, followed by a 21 aa transmembrane segment and a 51 aa cytoplasmic domain. CD93 is receptor for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). Soluble CD93 promotes the differentiation of monocytes to macrophages, phagocytosis of apoptotic cells, and inflammatory responsiveness to multiple TLR ligands.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 1
Don't Waste Your Money. Much Better Options Out There.
Format: Paperback
Don't Waste Your Money. Much Better Options Out There.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
★★★★★ 1
Don’t buy
Format: Paperback
Children’s books have no place for pushing sexual ideology with a controversial content narrative. This author should be banned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2025
★★★★★ 5
Great book, funny and enjoyable
Format: Hardcover
My 8 yo son asked us to purchase this book after Mr. Dan Santat visited his school. He loved this book, so much so that he has now read it 2 times. While he was reading, I would catch him giggling and smiling the whole time. He talks about Sashimi all the time and is looking forward to the next book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
★★★★★ 5
Enjoyable book
Format: Paperback
Enjoyable book I read along with my 10 year old son that enjoys these types of books.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
★★★★★ 5
Fun aquatic comic romp!
Format: Hardcover
Strange things are happening in Barnacle Bay! When Sashimi comes to shore, grabs a hoodie, and joins Miss Wilcox's classroom, the students ask a lot of questions, but don't get a lot of answers. Joey is assigned to show Shashimi around, but since he is new himself and a target of Billy's bullying, he's reluctant to be seen with a bug eyed student who sweats a lot. This, of course, is how Sashimi, who is really a fish boy, breathes. While he's living in the school and talking to Kevin, the class goldfish, he feels like he should investigate the Beast of Barnacle Bay, since there is a huge festival surrounding the creature. He has a bad experience at a grocery store with some high octane sugar soda and is kicked out after he goes nuts; Billy is there and takes him home to meet his grandfather. Poopdeck Pete is obsessed with the Beast, and gives tours of the bay. Sashimi tells Joey the truth after an incident where Sashimi tries to flush himself down the toilet: he is a fish boy and was chased ashore by Joey's grandfather, and has been living in the school. After meeting with Ben at the local history museum, Sashimi decides to enter the contest to catch the Beast, since there's a $10,000 prize. There is all kinds of drama in the community's participation in this, but in the end, Sashimi donates one of his own scales to the museum, and is rewarded with $500. He donates this money to the school, where budget cuts have been rife, and settles into life in Barnacle Bay. Poopdeck Pete's boat tours experience a resurgence with the interest in the creature, so Joey is happy as well. More adventures, perhaps ones including the very suspiciously damp Ben, are heading to shore.
Santat's illustrations are always a delight, and he brings Sashimi to life in an engaging way. There's even an informational diagram of how Sashimi breathes; of course, there are extra laughs since he is depicted in tighty whities! The use of the hood to hide his more defining aquatic features is inspired, since young readers these days live in hoodies, often (to my chagrin) with the hoods up. Santat must have a deep and abiding interest in the sea, since his 2022 Aquanaut also involves ocean life living on land. Sashimi is much happier and less traumatic than that graphic novel!
Sashimi gets himself involved in many ridiculous situations, which makes this a perfect book for older readers (who pretend to be too sophisticated for jokes about Poopdeck Pete) to read to younger ones. Sashimi gets revenge on Billy in a spitball fight, he has a massive sugar buzz and subsequent crash, and we get snarky but informative inserts about what a poop deck is named that and how Sashimi is able to live on land. The illustration style is colorful and unique, and will appeal to older readers who have been raised on Santat's picture books like Are We There Yet, Beekle, and After the Fall.
Dav Pilkey gets a shout-out in the dedication, which makes perfect sense, since readers of Captain Underpants and Dogman will be thrilled with Sashimi's odd adventures. Santat worked with Tom Angleberger on Princess Pit Stop, and must have absorbed some of Angleberger's Two-Headed Chicken Energy. I'm looking forward to the further adventures of this intrepid fish boy, and hope that he and Joey are able to calm Billy down quite a bit and can continue to support their struggling school.
The box that the publisher sent with the ARC was delightful, and contained a helpful water bottle (so Sashimi can keep breathing), a sticker, poster, and small container of "fish flakes" that I have on good authority actually contains Swedish fish candy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026