Pay in installments of $50.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 11 - Sep 16
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD34, hFc tagProduct Specification Species Human Accession P28906 Amino Acid Sequence Protein sequence(P28906, Ser32 Thr290, with C hFc)
Product Specification
| Species | Human |
| Accession | P28906 |
| Amino Acid Sequence | Protein sequence(P28906, Ser32-Thr290, with C-hFc) SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:53.5 kDa Actual:115 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/mg |
| Tag | with C-hFc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD34 is a transmembrane phosphoglycoprotein protein encoded by the CD34 gene in humans, mice, rats and other species. CD34 derives its name from the cluster of differentiation protocol that identifies cell surface antigens. CD34 was first described on hematopoietic stem cells independently by Civin et al. and Tindle et al. as a cell surface glycoprotein and functions as a cell-cell adhesion factor. It may also mediate the attachment of hematopoietic stem cells to bone marrow extracellular matrix or directly to stromal cells. Clinically, it is associated with the selection and enrichment of hematopoietic stem cells for bone marrow transplants.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 18 reviews
Sort
Product Reviews
★★★★★ 4
Very nice style and material
Color: Maple Leaf Wf157, Size: X-Large, Color: Maple Leaf Wf157, Size: X-Large
This top fit perfectly. I liked the v-neck. The material was so nice -- a tiny bit silky and not clingy. I loved the colors too. But I returned it, because for me (and I know this is really picky), the leaves and flowers were too big for my liking. I felt old in it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
★★★★★ 5
The Perfect Pair: SOJOS Oversized Polarized Aviator Sunglasses, Designer Look & HD UV400 Protection
Color: Brown Tortoise Frame/Brown Grading Lens, Lens Width: 54 Millimeters, Color: Brown Tortoise Frame/Brown Grading Lens, Lens Width: 54 Millimeters
The Perfect Pair: SOJOS Oversized Polarized Aviator Sunglasses for Women | Designer Look & HD UV400 Protection
Seriously, stop compromising. I needed that perfect pair of sunglasses that looks totally high-end, gives you that confident, high-impact vibe (exactly like the look in my picture!), but doesn't cost $200. I found them. If you’re searching for the best budget oversized polarized sunglasses, you can stop right here. The SOJOS Retro Aviators are your 2025 essential, proving you absolutely don't need a luxury price tag for luxury features and style.
These are a total statement piece. They nail the 2025 chunky aviator trend, that nostalgic, commanding shape that instantly elevates any outfit. I can wear them whether I'm dressed up for a high-fashion moment or just channeling a retro boho vibe with a fedora.
What I Love About Them (The Real Talk - Functionality Check)
To maximize your confidence in buying these, here are the three non-negotiables that make these my top recommendation:
1. The Lens Quality is the Real Winner (Protection & Clarity): When you go budget, you worry the lenses will be junk, but this is where SOJOS outperforms the competition. They feature HD TAC Polarized Lenses. That technical spec means zero blinding glare when I'm driving or near water, which is a must for me. Forget just "tinted plastic"—this is superior clarity. And, critically, the UV400 protection is guaranteed, blocking 100% of harmful rays—non-negotiable for eye health.
2. The Fit is UNREAL (Comfort Matters!): Style means nothing if your sunglasses squeeze your head and cause headaches. I love that these are incredibly featherlight and stay securely on my nose without being too tight. They feature durable, flexible hinges , which just adds to that feeling of quality you don't expect at this price point. For anyone who struggles with fit, user feedback confirms these are comfortable and don't cause issues even with large cheeks. This is the pair you can genuinely wear all day long.
3. Durability Functionality (Build Quality Checked): The flexible TR frame construction is not just lightweight, it's durable and bendable, making it less likely to break from a sudden shock compared to brittle plastic frames. The inclusion of high-quality, elastic flexible hinges further verifies the quality build, ensuring these shades are built to last, a true functional advantage at this price point.
From my everyday drives to weekend adventures, the Oversized Polarized Aviator shape and the dark, sophisticated lens color make these the most versatile shades I own. This is truly the pair that delivers a luxury look and essential eye protection at a smart price.
Stop settling for non-polarized, flimsy frames. Level up your look, your confidence, and your eye protection with the SOJOS Retro Aviator.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
★★★★★ 5
Stylish, lightweight aviators that look more expensive than they are
Color: Brown Tortoise Frame/Brown Grading Lens, Lens Width: 54 Millimeters, Color: Brown Tortoise Frame/Brown Grading Lens, Lens Width: 54 Millimeters
I picked these SOJOS aviator sunglasses as an everyday pair, and they’ve honestly exceeded expectations for the price.
The first thing that stands out is the look. They have that classic aviator style that works with pretty much anything, and they don’t look cheap or overly plastic. They actually pass for something much more expensive.
They’re also very lightweight and comfortable, which makes a big difference if you’re wearing them for longer periods. They sit well on the face without sliding around or feeling tight.
The lenses do a good job reducing glare and brightness. Most SOJOS models use UV400 lenses that block harmful UVA/UVB rays �, so they’re not just for looks—they actually protect your eyes as well.
Amazon
For everyday use like driving, walking, or being out in the sun, they perform exactly how you’d want.
Pros:
• Clean, classic aviator design
• Lightweight and comfortable for long wear
• Good glare reduction and UV protection
• Great value for the price
Cons:
• Not premium lens quality
• Frames are lightweight (durable, but not luxury-level)
Conclusion:
These are a great everyday pair of sunglasses if you want style, comfort, and decent performance without spending a lot. Perfect for daily use where you don’t want to worry about damaging expensive shades.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
★★★★★ 5
Love ❤️ this brand!!
I am a fan of this brand!! I have bought from them a couple times and have been pleased each and every time. These are just like the others we have gotten....they are lightweight, comfortable, durable (had them for months and still look good with no problems!), they look so cute on - can dress up or down, the price was great, they fit well, came with a cleaning cloth too!, don't slip off and block the sun well! I love this color, its neutral and pretty much goes with anything! I will happily buy from the again!! Currently my daughter has them so I cannot take a photo but I did take one of the same type just pink in color (which i also love love love lol). Really hope this helps!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
★★★★★ 4
Good for price
Color: Brown Tortoise Frame/Brown Grading Lens, Lens Width: 54 Millimeters
Style is great and color ! My daughter grabbed them and easily fixable as well if they bend. For the price, a good product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026