SKU: 58239173435

CEACAM-6/CD66c His Tag Protein, Cynomolgus

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-6/CD66c His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CEACAM6, CD66c, CEAL, NCA Accession XP_014979566. 2 Amino Acid Sequence Gln35 Gly320, with C terminal 8*His

Product Specification


Species Cynomolgus
Synonyms CEACAM6, CD66c, CEAL, NCA
Accession XP_014979566.2
Amino Acid Sequence Gln35-Gly320, with C-terminal 8*His QLTIESRPFNVAEGKEVLLLAHNLPQNTLGFNWYKGERVDAKRLIVAYVIETQQTTPGPAHSGRETVYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGRFWVYPELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNDQSLPVSPRLQLSNGNRTLTLLSVKRNDAGAYECEIQNPVSANLSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAASNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 55-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Duxbury M S. et al. (2004) Overexpression of CEACAM6 promotes insulin-like growth factor I-induced pancreatic adenocarcinoma cellular invasiveness. Oncogene. 23(34): 5834-5842.

2、Lewis-Wambi J S. et al. (2008) Overexpression of CEACAM6 promotes migration and invasion of oestrogen-deprived breast cancer cells. Eur J Cancer. 44(12): 1770-1779.

Background

Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) (CEACAM6) is also known as CD66c (Cluster of Differentiation 66c), CEAL, NCA, and is one of seven human CEACAM family members within the immunoglobulin superfamily. Human CEACAM-6 is a 90 kDa, GPI-linked membrane protein that contains a 34 amino acid (aa) signal sequence, a 286 aa extracellular domain (ECD), and a 24 aa hydrophobic C-terminal propeptide. CEACAM-6 contains one N-terminal V-type Ig-like domain (N domain), followed by two C2-type Ig-like domains. It shows considerable glycosylation, including (sialyl) LewisX, which mediates binding to E-selectin, galectins and some bacterial fimbrae. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 58239173435

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LunaFae
Alexandria, US
★★★★★ 5
Jewelry Box
Love this Jewelry Box,nice quality and value
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 5, 2026
P
Verified Purchase
Piper Sandifer
Birmingham, US
★★★★★ 5
Beautiful, Durable Jewelry Box with Amazing Storage — Everyone Wants One!
Color: White + Gold
This jewelry box is absolutely adorable! We ordered it as a birthday gift for a little girl, but once it arrived, every girl in the house (including me!) wanted one of our own. The outside is beautiful and durable, and it comes in multiple colors. The top is lockable and includes two removable watch holders, which is such a nice touch. Inside, everything is lined with soft velvet that feels really high-quality. There are four different drawers, each with different compartment sizes so you can organize rings, earrings, bracelets—everything. My favorite part is the two side doors that snap open to reveal space for 16 necklaces total (eight on each side). The hooks make it easy to hang them without tangling, and each side has a little pouch to catch the ends. It’s honestly the most thoughtfully designed jewelry box I’ve found at this price. Beautiful, functional, and the perfect gift!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026
F
Verified Purchase
Fortune Moran
Belleville, US
★★★★★ 5
Stylish, elegant with so much room!
Color: White + Gold
This jewelry box is amazing. So well made and very stylish. Plenty of storage for rings, bracelets and earrings. The side panels hold plenty of necklaces. It even has compartments for watches. This was exactly what I wanted. I even bought a second one as a gift for my daughter!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 26, 2026
P
Verified Purchase
pinguinatuerta
San Leandro, US
★★★★★ 5
Well made & pretty!
Color: Gold
Love it! Great storage options. Easy to access all drawers & side pockets. Looks nice when closed. Kind of an "art deco" look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
B
Verified Purchase
Blonde Blond 66
Boise, US
★★★★★ 5
A Treasure Chest of Organization!
Color: White + Gold, Color: White + Gold
Unlock the Treasure Chest of Organization! If you’ve ever dreamed of a jewelry box that feels like a personal vault for your treasures, the Homde Synthetic Leather Huge Jewelry Box is your answer. From the moment you open its mirrored lid, you’re greeted by a spacious, thoughtfully designed interior that can accommodate an impressive collection from watches, necklaces, rings, earrings, and more. Whether you’re a jewelry enthusiast or simply want to keep your accessories beautifully organized, this box delivers in both style and substance. Why It Stands Out: • Generous Size: This isn’t your average jewelry box. It’s huge! You’ll find dedicated compartments for every type of jewelry, so even the most extensive collection fits comfortably. No more tangled necklaces or misplaced rings everything has its place. • Secure Storage: The included keys let you lock up your valuables with confidence. Whether you’re safeguarding heirlooms or everyday favorites, you’ll appreciate the extra peace of mind. • Elegant Design: Wrapped in sleek synthetic leather, the box looks stunning on any dresser or vanity. The mirrored lid adds a touch of luxury and makes it easy to check your look as you accessorize. • Versatile Organization: With specialized slots and drawers for watches, necklaces, rings, and earrings, you’ll spend less time searching and more time enjoying your jewelry. Final Thoughts: The Homde Jewelry Box is more than just storage it’s a statement piece that brings order and elegance to your daily routine. If you want a jewelry organizer that’s as impressive as your collection, this is the one to get. Unlock it, fill it, and enjoy the beauty of true organization!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026

recommand products