SKU: 60178646259

Cyclophilin A His Tag Protein, Mouse

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cyclophilin A His Tag Protein, MouseProduct Specification Species Mouse Synonyms Peptidyl prolyl cis trans isomerase A; PPIase A; SP18; PPIA; CYPA Accession P17742 Amino Acid Sequence Met1 Leu164, with C terminal 8*His Tag MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQLHHHHHHHH Expression System E. coli Molecular Weight 19kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g

Product Specification


Species Mouse
Synonyms Peptidyl-prolyl cis-trans isomerase A; PPIase A; SP18; PPIA; CYPA
Accession P17742
Amino Acid Sequence

Met1-Leu164, with C terminal 8*His Tag MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQLHHHHHHHH

Expression System E.coli
Molecular Weight 19kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Haendler B., et al.,(1987), Complementary DNA for human T-cell cyclophilin. EMBO J. 6:947-950. 2. Haendler B., et al., (1990), Characterization of the human cyclophilin gene and of related processed pseudogenes.Eur. J. Biochem. 190:477-482. 3. Ota T., et al.,(2004), Complete sequencing and characterization of 21,243 full-length human cDNAs.Nat. Genet. 36:40-45.

Background

Peptidyl-prolyl cis-trans isomerase A, also known as PPIase A, Rotamase A, Cyclophilin A, Cyclosporin A-binding protein, PPIA and CYPA, is a cytoplasm protein that belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins (CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. PPIA / Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA / Cyclophilin A is secreted by vascular smooth muscle cells in response to inflammatory stimuli, and could thus contribute to atherosclerosis. It is not essential for mammalian cell viability. PPIA / Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60178646259

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Midwest Mama
Cuba, US
★★★★★ 4
Nice, thick & comfy but came w/ punctures in foam; seller provided discount
Color: Purple, Color: Purple
I love the mat. It's thick and very comfortable on my knees. However, when I opened it for the first time at my yoga class, there were several cuts or punctures in the foam. I attempted to return it and the seller offered me a 10% refund due to the damage. I am concerned that the mat may deteriorate due to the damage it came with, but I need it and have no idea if the cuts will matter over time. So I accepted the $3 refund and am keeping the mat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2024
A
Verified Purchase
Amazon customer
Alexandria, US
★★★★★ 5
Best mat purchase yet
Color: Pink
I love this mat. I wish they had it in larger sizes. The only one I have truly non slip. Extremely comfortable especially on my back. Great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
L
Verified Purchase
L l stearns
Carnegie, US
★★★★★ 5
Great workout mat
Color: Green
It’s very thick and soft so it makes exercising a lot easier. It rolls easily ready to store. And it seems very durable. It is also flexible for certain exercises for balance.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
T
Verified Purchase
TJV
Carnegie, US
★★★★★ 5
Very sturdy. Great Quality
Color: Navy Blue
This is a very dense, thick mat. It's great if you have bad knees or just need/want a thicker mat. The carrying strap with velcro closures is easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
C
Verified Purchase
Charl8
Bozeman, US
★★★★★ 5
Great cushioning, easy storage
Color: Blue
I am so happy I bought this. I do back stretches, and need to be on the floor.. Getting up & down is hard at 77, and carpets are hard. This helps sooo much! I don’t hurt my knees when getting down or getting up. The mat is comfortable and provides plenty of padding. It is easy to roll up and store with the included strap. I am tall, and there is extra length, so my head and feet are on the mat. This was a good purchase! This has not torn, and wipes down easily. It doesn’t attract dog hair, which is another reason I wanted a mat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026

recommand products