SKU: 61564828387

Human ST2, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 13 - Sep 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ST2, His tagProduct Specification Species Human Synonyms sST2, Interleukin 1 receptor like 1 Accession Q01638 Amino Acid Sequence Protein sequence(Q01638, Lys19 Ser328, with C 10*His)

Product Specification


Species Human
Synonyms sST2, Interleukin-1 receptor-like 1
Accession Q01638
Amino Acid Sequence

Protein sequence(Q01638, Lys19-Ser328, with C-10*His) KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:36.6kDa Actual:55-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The ST2 cardiac biomarker (also known as soluble interleukin 1 receptor-like 1) is a protein biomarker of cardiac stress encoded by the IL1RL1 gene. ST2 signals the presence and severity of adverse cardiac remodeling and tissue fibrosis, which occurs in response to myocardial infarction, acute coronary syndrome, or worsening heart failure. ST2 provides prognostic information that is independent of other cardiac biomarkers such as BNP, NT-proBNP, highly sensitive troponin, GDF-15, and galectin-3. One study indicated that discrimination is independent of age, body mass index, history of heart failure, anemia and impaired kidney function or sex.sST2(Soluble ST2) is a biomarker for risk stratification in patients with heart failure (HF) and prognostic assessment. Compared with BNP and NT-proBNP, ST2 is not affected by age, factors such as BMI and renal insufficiency.Different with so many other heart markers, the level of ST2 varies rapidly with the patient's condition. This means that ST2 can help clinicians respond faster. The increase of sST2 level (> 35ng/ml) was highly correlated with the severity of heart failure which can be used to predict readmission and mortality.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61564828387

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Roel Y.
Dallas, US
★★★★★ 5
Great product
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
Great value for the size. Easy to apply and absorbs quickly wherever you apply it. Does not leave any oily residue and it smells fragrant. Moisturizes and works quickly. Skin feels instantly smooth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
D
Verified Purchase
DLW
Cuba, US
★★★★★ 5
This product is da' BALM! (a softening balm that's the best moisturizer for all skin types!)
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
So many of these are all over social media and I wasn't sure to order a whipped version, or just a balm, so I went with the balm and I'm totally satisfied. No breakouts to my sensitive, mature dry skin, and the scent is light citrus and non-lingering. I suggest to lightly swirl finger tips inside the container in a circular motion and scoop a tiny amount then rub both fingertips together to warm the product as this is key to make it glide smoothly onto your skin, otherwise, you are having to re-dip into the product and use more than you will need. I use it AM/PM right after my facial serums, and follow with SPF moisturizer. I'm not a fan of foundation or powder to avoid the caked on look, but use a little creme blush when heading to work, and will dab a little concealer where needed too. I've been using my Ancestral Haven Beef Tallow/Honey Balm a couple of weeks now and my pores seem smaller than when using any of my previous French pricey skin products! I use this on my face and lightly under eyes, neck, decollete and the heels/sides of my feet every morning. Any remaining product I apply to top my hands. It absorbs quickly without being greasy. If you experience an oily result, then lighten your next application as the product is light if you don't warm it up with your fingertips. I highly recommend and can't wait to tell my dermatologist about it too! Oh and my 86 years young mom uses this daily and loves it too! (Christmas gifts coming her way so she doesn't deplete my supply - lol).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2025
A
Verified Purchase
Amy
Lowell, US
★★★★★ 5
Tried 100’s of product and this is all my son lets me use on him willingly!
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
The ONLY product I can put on my child’s eczema and allergy problematic skin and not irritate his skin. My son has TERRIBLE SKIN that is EXTREMELY sensitive and to top that off, he also picks at his scabs. This is the only product I’ve ever been able to use on him and use up the entire product because he doesn’t breakout in a rash, it doesn’t sting his skin in even the worst of areas that are freshly picked scabs, and that’s a huge deal for us! It is extremely moisturizing and although slightly greasy, it’s a much better feeling on the skin then what you get from a Aquaphor or petroleum jelly. That and my son absolutely cannot stand the texture of Aquaphor and petroleum jelly, but with the tallow, he doesn’t hardly say a word as long as I don’t put it on too thick. This can be layered for extra protection in problem areas, or worked into the skin and absorbs quite nicely and feels fantastic! It has a very mild scent that I truly love, but the scent doesn’t really travel outside the jar so you know it’s very minimal. After the hundreds of products that I’ve tried and the thousands of dollars wasted over the years, I will continue to purchase this as my holy grail for my son’s extremely sensitive skin condition. Thank you so much!!!! And I will upload pictures of before and after so be sure to see how well it’s healed his skin within a week of use!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
T
Verified Purchase
Tonia Le Vangie
Carnegie, US
★★★★★ 4
Good product.
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
Seems to work great, but time will tell.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
L
Verified Purchase
Lori Sharpe
Boise, US
★★★★★ 5
Amazing smell, awesome price, and nothing synthetic
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
This is a new staple in my skincare regimen! With no synthetic perfumes dyes, or preservatives, it smells wonderful, melts into my skin without leaving a greasy film. I use it morning and evening on my face and body, and my skin never feels dry. It leaves my skin soft and moisturized and I have this on subscription. The price is great, at about $20 for 5 Oz of nonwhipped, but soft, balm.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products