SKU: 61705221753

CD47 His Tag Protein, Mouse

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 27 - Oct 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD47 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD47 Synonyms MER6, IAP, OA3 Accession Q61735 Amino Acid Sequence Gln19 Lys140, with C terminal 8*His QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Mouse
Antigen CD47
Synonyms MER6, IAP, OA3
Accession Q61735
Amino Acid Sequence

Gln19-Lys140, with C-terminal 8*His 
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-43kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.

Background

CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61705221753

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Poorboy5764
Waukegan, US
★★★★★ 5
Great Timex Watch
Color: Black/Yellow
This Timex Ironman watch arrived on time and is of great quality. I have used these watches for years and have NO complaints about their longevity, accuracy, or dependability. I will definitely purchase again if needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
R
Verified Purchase
Rikeshay
Birmingham, US
★★★★★ 5
Item as described.
Color: Dark Blue
A timeless tradition of a great design and useful watch. Have been using this watch design for over a 30 years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
B
Verified Purchase
Buck
Whiting, US
★★★★★ 5
Great thowback to the OG Ironman, but Amazon's listing gets it undue negativity.
Color: Black/Yellow
Amazon's listing is not very good with it's wording so this watch has gotten undue negative reviews. I've seen this model listed as both the Endure 30 and the Original 30 Shock, it has 1 alarm with 3 different modes (not 3 separate alarms), 200m WR, ISO shock resistance, (reverse) Indiglo with night mode, 2 time zones, 12/24hr time, 30 lap stopwatch, 24hr countdown timer (repeatable), and day/date (MM.DD or DD.MM). Its basically a slightly updated feature set compared to an Ironman 8-lap. This watch is great, it's got the look of the original Ironman 8-lap with modern guts. The only minus for me is it could be a little slimmer on the wrist, but I also didn't realize it was shock resistant when I bought it. For comparison, it is a few mm smaller in all dimensions than a G-Shock G2300/G2310/GW2310 series. The band is similar to G-Shocks in that it is formed/molded around the wrist but like the case it's still slimmer in the way it wears around the wrist. Not as slim as an F91W but not as massive as any G-Shock basically. The module has a better display with bigger numbers than the above mentioned Casios. With the exception of the lap memory, the G23## G-Shocks have more features, but the Endure 30 is much easier to use thanks to the display and larger buttons. If you want 3 alarms you need the very similar Classic 30. The main differences being the Classic has 3 separate alarms (not 1), occasion reminders and 3 time zones but losses the Ironman 8-lap look, the shock resistance and it's only 100m WR. The Classic seems to come in at least two case varieties (chunky or slim), two sizes and many color combinations. If you only need the Endure 30's features but want a different shape/size/style/slimmness, I believe the Essential 10/30 and BASIC Transit models are functionally the same with only different lap memories, WR, and no shock resistance. Unfortunately, Timex doesn't easily identify the actual module used in a watch like Casio, so the best way to figure out what features a watch has is to lookup the watch model on the Timex website. Of course the manuals do not always match the marketing names they have used over the years (Endure/Classic/Essential/etc), and each manual covers a few shapes/sizes of watch but just search for the model number in the manuals sections and you'll eventually find the right one. If no manual pops up right away delete digits from the right end of the model number until a manual is found, I believe those last digits only indicate slight variances in style/color that are not important to functionality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2021
H
Verified Purchase
Hudson
Lake Worth, US
★★★★★ 1
Good interface but unwearable watch band
Color: Black
This review will be divided into 3 sections: looks, usability, and comfort. LOOKS I guess there's not much to say as style is very individual. I think this watch looks good for what you pay for it. USABILITY What I liked about this watch is that I could use it right out of the box. I have had basic Timex digital watches before (never this exact interface), and I was able to quickly figure it out. A quick glance at the manual to make sure I wasn't unaware of any features and I had 100% grasp of all the watch's features. The Timex interface puts many others to shame with its user-friendliness. On this model Timex has added a 'guide' on the display that tells you which button will do what-- increase number, decrease number, etc. This is cool. If you're even remotely handy with interfaces, once you learn this one, you'll know it backwards and forwards, and even if you forget, there's the in-display guide. The functions are standard for a Timex digital-- time and date, stopwatch with lap timing, countdown timer, and alarm. There is a 2nd time zone but no dedicated mode for it. You access it by holding the 'start' button when in the time mode. I like this feature as I occasionally need to know when to call people in 1 particular time zone. But, for example, if you are often switching back and forth between 2 time zones, you will have to reset the time to have the watch display the correct time at all times. And if you need more than 2 time zones, sorry, out of luck. Stopwatch (chrono) is good. Don't use the lap counter much but it seems to work well. Some have complained that the 'start' and 'stop' should be on the same button. Overall, it is a very uncluttered and usable interface. At first I thought it was very inaccurate at timekeeping, but it must have gotten accidentally reset because over the few months since I set it, it's only a couple seconds off from time.gov. very good timekeeping. It seems very water resistant. I have taken it swimming, surfing, and it held up fine. I haven't thoroughly tested its shock resistance but it has done some hiking and climbing where it got banged around a bit and it still works. COMFORT Unfortunately what the watch has in user interface usability, it totally lacks in comfort. The strap is a huge disaster. It is very rigid and uncomfortable. The 'waffling' or indented designs near the bezel on each side of the strap create areas where the strap digs into the wrist. with any prolonged wearing, it gets worse and worse until your wrist is begging you to take it off. The strap is just absolutely godawful. I have read reviews where G Shock owners said it was very good, well though out and comfortable. If that is the case, I shudder to imagine what a G Shock is like on the wrist. If constant pinching around sensitive areas on the side of the wrist seems like it would be the kind of thing to bother you, avoid this watch. I tried swapping it for another Timex band, which amazingly enough was uncomfortable it a DIFFERENT area! It seems Timex doesn't put much thought into their bands-- no part of the band should dig into the wrist. That's just obvious. CONCLUSION I really want to like this watch, I do. It's good-looking. It's very usable in terms of features. But the strap is terrible, so much so that the watch is unwearable. Unfortunately it took me about a week to figure this out, during which time the watch got sufficient wear so that it is no longer new, returnable condition. I am keeping it, using it as a 'beater' watch in the gym (I put my watch on the ground in the gym). If you purchase it I recommend you wear it for a good few hours while not doing anything that will scratch it, so that you can return it if need be.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2014
C
Verified Purchase
Curly and natural
West Palm Beach, US
★★★★★ 5
Best purchase ever!!!
Color: G9901: Gold band & Gold dial, Color: G9901: Gold band & Gold dial
The best fit,size, quality,weight and value for the individual in my life. You can see all the moving parts in the watch and he loved it!!! Seriously considering getting more for my kids and another color for him.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026

recommand products