SKU: 65229846937

Human IL-25, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-25, His tagProduct Specification Species Human Synonyms Interleukin 17E (IL 17E), IL17E Accession Q9H293 Amino Acid Sequence Protein sequence(Q9H293, Tyr33 Gly177, with C 10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 18. 4 kDa Actual: 20, 23, 27 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Human
Synonyms Interleukin-17E (IL-17E), IL17E
Accession Q9H293
Amino Acid Sequence

Protein sequence(Q9H293, Tyr33-Gly177, with C-10*His) YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:18.4 kDa Actual:20, 23, 27 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-25 (IL-25) – also known as interleukin-17E (IL-17E) – is a protein that in humans is encoded by the IL25 gene on chromosome 14. IL-25 is produced by many cell types. This cytokine can induce NF-κB activation, and stimulate the production of IL-8 (named also CXCL8), which is the major chemotactic substance of neutrophils. Another important function of interleukin 25 is to support the Th2 immune response. IL-25 has been shown to induce the production of IL-4, IL-5 and IL-13. Because IL-25 promotes the development of a Th2 immune response, it acts to protect against several bowel infections caused by helminths. IL-25 is also referred to as the regulator of IL-9 production. Another function of IL-25 is the activation of natural lymphoid cells 2 (ILC2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65229846937

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Clark Family
Boise, US
★★★★★ 4
Smells Great and Works Well
Size: 3 Ounce (Pack of 1), Style: Cool Down Lotion
Smells great and goes on really smoothly. Skin felt soft and refreshed after use. It is pretty "liquidy" and can come out of the bottle a little on the quick and messy side, but nothing too terrible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2025
J
Verified Purchase
jon
Boise, US
★★★★★ 5
Works VERY well, NOT sticky, smells AMAZING!
Size: 16 Ounce (Pack of 1), Style: Cool Down Lotion
So... I had sunburn... very painful across my whole back, top of my forehead & the back of my arms. Stupid, I know... USE SUNBLOCK PEOPLE! However, if u don't because u want "a little color" and end up like me, then I highly recommend this after-sun product. It smells amazing and doesn't leave the sticky residue like green Aloe Vera. After rubbing it in, my hands feel super soft. It gives my skin the hydration it needs so I won't peel (and lose the tan I was desperate for). My personal hack... After the sensitivity of the burn calms, I like keeping a bottle in the fridge for that extra cooling sensation. I love this stuff! Sun Bum is a great product... u should definitely try the sunblock tho, it worked where I applied it! I didn't take a pic for obvious reasons, but when u rub it in, it will dry clear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 14, 2025
H
Verified Purchase
HEATHER H
Lexington, US
★★★★★ 5
Cruise
Size: 8 Ounce (Pack of 1), Style: Cool Down Lotion
Smells great just as described
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
Shawshank
Lake Worth, US
★★★★★ 5
Works Exceptionally well without feeling like you just applied Super Glue to your Body.
Size: 8 Ounce (Pack of 1), Style: Cool Down Lotion
I would provide a picture of the bottle but TSA took mine. This is some of the best post sunburn lotion I have ever used. I just finished writing a review of a sunblock lotion that did a great job, what I did not mention was the only sunburn I got was on my lower back where I didn't apply that lotion. It was a pretty uncomfortable burn, especially when I tried to sleep in the forward berth of a sailboat, or when I tried to wear swimming trunks with an elastic type waist, thankfully I had a couple of sets of board shorts that alleviated that irritation. But back on point. What I like the most about this lotion is how it applies. Usually, in the past, I did not like using aloe lotions because I felt like it was like glue when it dried on my skin and I felt like it made my skin feel tight. This stuff applies extremely well and I'm not exaggerating one bit when I say the relief is IMMEDIATE. As soon as I applied it to my sunburn, I felt immediate relief! It also doesn't feel like you just spread a bunch of super glue on your burn when it dries. It absorbs into your skin, cools your "hot spot" and doesn't leave a residue to get onto your clothing, or onto the mattress in my berth on the sailboat. Win and win. I can't recommend this product enough. The only negative experience was when TSA snagged my bottle going through security in Miami because I forgot to put it in my checked bag. But that was just the good ol' TSA doing their job in the amazing way they always do. (sarcasm dripping sounds) It works so well that I bought a replacement. So I would recommend purchasing the 3 oz tube if you plan on traveling with it. This is an excellent product, I'm not sure how long it lasts, because I forgot my sunburn was nothing me, or it enabled me to fall back asleep after applying. It does have that coconutty smell, but it's not like I just spent 3 hours in a hot tub filled with coconut oil. Hmmm... Idea forming... Anyway, purchase with confidence, this Texan who got a sunburn on his lower back and treated it with Sun Bum approves this message.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 27, 2021
J
Verified Purchase
Jen
West Palm Beach, US
★★★★★ 5
Perfect Little Sun Care Kit — Great for Travel!
Style: Original, Style: Original
I love this Sun Bum Road Tripper set! The travel‑sized products are perfect for tossing into my beach bag or carry‑on, and everything smells amazing. It has all the essentials you need for a day in the sun without taking up a ton of space. The quality is exactly what you expect from Sun Bum — gentle, effective, and reliable. This is such a convenient little kit for trips, beach days, or keeping in the car. Definitely a must‑have for anyone who loves being outdoors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026

recommand products