SKU: 6701680963

CD5 His Tag Protein, Human

Sale price$278.10 Regular price$309.00
Save 10%

Pay in installments of $77.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 24 - Sep 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD5 His Tag Protein, HumanProduct Specification Species Human Synonyms CD5, LEU1 Accession P06127 Amino Acid Sequence Arg25 Asn371, with C terminal 10*His

Product Specification


Species Human
Synonyms CD5, LEU1
Accession P06127
Amino Acid Sequence

Arg25-Asn371, with C-terminal 10*His RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

50-55kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Zola H. et al. (2007) CD molecules 2006-human cell differentiation molecules. J Immunol Methods. 318(1-2): 1-5.

2、Ho I C. et al. (2009) GATA3 and the T-cell lineage: essential functions before and after T-helper-2-cell differentiation. Nat Rev Immunol. 9(2): 125-135.

3、Matesanz-Isabel J. et al. (2011) New B-cell CD molecules. Immunology Letters. 134(2): 104-112.

Background

CD5, one of the earliest markers used to identify T cells, is a 67 kD transmembrane molecule that is constitutively expressed on all T cells and is a negative regulator of lymphocyte function. T-cell surface glycoprotein CD5 is also known as Lymphocyte antigen T1/Leu-1 and LEU1. CD5 is also a negative regulator of thymus cell stimulation. Lack of CD5 promotes positive selection of poorly selected thymocytes and increases negative selection of high-affinity clones. Along with its negative effect on T cell stimulation, CD5 was shown to diminish activation-induced cell death (AICD) through its interaction with casein kinase 2 (CK2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 6701680963

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Himanshu Sukheja
Houston, US
★★★★★ 5
Amazing MagSafe phone stand
I recently purchased this MagSafe car phone mount, and it has been a game-changer for my daily commutes. The installation was effortless—just snap it onto the air vent, and you’re good to go. What stands out the most is the strong MagSafe connection. My phone stays securely in place even on bumpy roads, and removing it is just as seamless. The minimalist design fits perfectly with my car’s interior, and it doesn’t block my view like other bulkier mounts. Another highlight is the 360-degree rotation feature, which makes adjusting the angle for navigation or hands-free calls incredibly easy. It’s sturdy, reliable, and eliminates the need for clamps or adhesives. Overall, this is a must-have for anyone who uses their phone for GPS or music while driving. Highly recommended for MagSafe-compatible phones!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2024
C
Verified Purchase
CML
Los Angeles, US
★★★★★ 5
Great Phone Mount
This is a great little phone mount! Simple and effective. I’ve been wanting something for when I am pulled over at a super charger to be on a call or watching something on my phone without holding it or putting it in the cup holder. Works super well with my MagSafe case although it does come with extra magnets as well in case you don’t have a MagSafe case. Highly recommend! Easily attaches to the screen, no sticky residue or risk of sun staining on the dash like other mounts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2025
L
Verified Purchase
Lily
Whiting, US
★★★★★ 5
Best one so far!
This is a great device! Not my first one but definitely better than I had before! It mounts on the side of the screen, which is very convenient as my other one was sticky, so I had to leave it with my other car. The handles rotate well to give you any position that suits you. There is some good suction, so it sticks well and doesn’t fall. It’s good quality and sturdy. The phone magnets very well to it and also doesn’t fall. I rotate it any way I want but mostly vertically and diagonally. I had it for a while now so can give you my honest opinion. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2025
J
Verified Purchase
Joe
Fort Morgan, US
★★★★★ 5
Recommend
Color: Black
This a great little phone mount. It works for my iPhone 17 pro max. I drive a lot of dirt roads where I live in the mountains, and the magnet holds up to plenty of bumps without dropping my phone. Easy to install. Pros: -very simple installation -strong magnet -arm rotates for adjustment -ball and socket joint allows tilting with a good amount of resistance to hold its position (when fully tightened) Cons: - for model 3 users, anything other than next to the steering wheel can block a portion of your windshield viewing area -could have more modularity if offered with more arm attachments Conclusion: RECOMMENDED. Very stable and functional mount with a minimalistic design that still allows for some adjustability. If magnet weakens over time, or the sun damages the plastic to the point of breaking from brittleness then I will post updates. I will also update for any modifications I make for more adjustability.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
J
Verified Purchase
Jamie J. Breustedt
New York, US
★★★★★ 5
This economical solution works perfectly
Color: Black
Very happy with this car mount. The magnet is plenty strong to securely hold my iPhone in its magnetic loop case. It’s plastic but it’s sturdy and fits on my Model 3’s screen perfectly. It has an adjustable height that I can mount my phone with full clearance of my steering wheel. Don’t waste your money on a metal mount, this inexpensive mount serves the need perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026

recommand products