SKU: 68090964206

Mouse IFN-alpha1 Protein, His Tag

Sale price$31.50 Regular price$35.00
Save 10%

Pay in installments of $8.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IFN-alpha1 Protein, His TagProduct Specification Species Mouse Synonyms Interferon alpha 1, IFN alpha 1, Ifna1 Accession P01572 Amino Acid Sequence Protein sequence (P01572, Cys24 Lys189, with C His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed MW: 20 kDa Purity 95% by SDS PAGE

Product Specification


Species Mouse
Synonyms Interferon alpha-1, IFN-alpha-1, Ifna1
Accession P01572
Amino Acid Sequence

Protein sequence (P01572, Cys24-Lys189, with C-His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interferon alpha-1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68090964206

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sierra & Matt
Birmingham, US
★★★★★ 5
Comfortable & Dad-Bod Approved!
Size: X-Large, Color: White, Size: X-Large, Color: White
I purchased this shirt in advance of our 10th Anniversary Cruise, and I'll say it was a success! I had never worn a shirt like this before, but I am now a fan. Cool, breathable, comfortable, and my wife loved it! Definitely Dad-Bod Approved. Quality was nice and I think was priced fairly well (might have bought on a sale). The size was perfect. I'm 6'2", 275lbs in these photos, and the XL was a great fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2024
R
Verified Purchase
RaymondFRevalee
Natrona Heights, US
★★★★★ 4
Not bad so far
Size: Small, Color: Light Yellow
mixed feelings about the quality... only worn/washed once and there are some dangling threads which I had to cut off which might lead to further degradation of longevity etc. The fit is a bit snug between S and M, I chose small regarding the closest fit to my chest size but it's ok. The fabric is thin so if you are a guy that doesn't mind showing off your form and fitness this shirt is flattering. The fabric is texture, light and thin so there is comfort regarding the lightness of wearing it. One could go a size larger for looser fit and more comfort but I actually like the tighter fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2025
S
Verified Purchase
Sir Pain
Port Orchard, US
★★★★★ 5
Perfect summer shirt...
Size: 3X-Large, Color: White
I am one that ALWAYS look at the 1 star reviews first. When I brought this shirt I did not... I brought 4 more in different colors. I have now looked at the 1 star reviews and I have to disagree.. Most say they are too thin. When it's 90 - 100 degrees outside this shirt is PERFECT.. It is airy and relaxing. I found it to be also perfect in size. I came back to order more but they don't have a few colors I am looking for. This worked for me all the way around..
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 23, 2025
F
Verified Purchase
Frugalliving
Port Orchard, US
★★★★★ 5
Flattering and classy
Size: Medium, Color: White
Thin but I love it that way. Is not overly wrinkled after ironing but wrinkles terribly when washed. Fits well not tight or too loose. Buy your exact size. The white is very classy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2025
J
Verified Purchase
Jack
Charlottesville, US
★★★★★ 1
Very Thin, low quality, runs small
Size: Medium, Color: Light Green
Way too thin. It's completely see-through, and the fit runs small. I forgot to return it and wound up giving it away to Goodwill.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 27, 2025

recommand products