SKU: 72412822260

VSIG3/IGSF11 Fc Chimera Protein, Human

Sale price$259.20 Regular price$288.00
Save 10%

Pay in installments of $72.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VSIG3/IGSF11 Fc Chimera Protein, HumanProduct Specification Species Human Antigen VSIG3 IGSF11 Synonyms VSIG3, IgSF11, CXADRL1, Bt IgSF, CT119 Accession Q5DX21 1 Amino Acid Sequence Leu23 Gly241, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen VSIG3/IGSF11
Synonyms VSIG3, IgSF11, CXADRL1, Bt-IgSF, CT119
Accession Q5DX21-1
Amino Acid Sequence

Leu23-Gly241, with C-terminal Human IgG1 Fc

LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215–21.

Background

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72412822260

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Noba Henderson
Cuba, US
★★★★★ 5
Flat tire… try this.
Size: 1 Gallon + Tool, Set name: Small Tire/Bicycle Formula
For husband, that’s what he puts in our tires great price and works well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
C
Verified Purchase
Chris
Fort Morgan, US
★★★★★ 5
Go Ridding and Go Flatless with QuickStrike tire sealent
Size: 1 Gallon + Tool, Set name: Off-Road Formula
I’ve tried several tire sealants over the years on my ebikes and scooters, but FlatOut QuickStrike is by far the best I’ve used. From the moment I added it to my bike tires, I noticed a difference—it’s incredibly easy to install, and you don’t have to convert to tubeless to benefit from its protection. The formula is thin and spreads quickly, sealing punctures almost instantly so you don’t lose much air. What I feel that really stands out is how effective it is. I ride my ebikes through rough terrain with lots of thorns and debris, and since using FlatOut QuickStrike, I haven’t had a single flat ( unlike before ). Even when I’ve picked up multiple punctures, the sealant has handled them all without a problem. I feel that the peace of mind it gives me is priceless, especially on long rides or commutes where a flat could ruin your day ( and It has in the past ). Another big plus is that it’s a one-time application—it won’t dry out or turn into a mess inside your tire ( like that Green Stuff ). It’s also safe for both tubes and tubeless setups, and works well in my 20 inch and 14 inch tires. I’ve used it on my ebikes and scooters and the results have been consistently impressive. Make me feel confident of the durability of my tires on my ride. I bought the gallon bottle because I have a few ebikes and scooters. this stuff works great! If you want to spend less time fixing flats and more time enjoying your ride, this is the sealant to get. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2025
M
Verified Purchase
Mama-Corvi
Grantham, US
★★★★★ 5
Fat tire savior
Size: 1 Gallon + Tool, Set name: Off-Road Formula
The best fat tire and dirtbike sealant we have found and love the gallon size. Pump clogs but clears with a strong push and love that it is water cleanup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
J
Verified Purchase
JRTX
Alexandria, US
★★★★★ 5
Worked perfectly for me. Sorry I waited so long.
Size: 1 Gallon + Tool, Set name: Off-Road Formula
I was clearing a field full of mesquite trees, and my tractor tires were getting destroyed. Mesquite has nasty 3-inch thorns, and I was plugging tires constantly. Eventually, all four tires were flat at the start of each day. These tires had been plugged more than 10 times each. I bought FlatOut Quick Strike and followed the instructions exactly. The pump dispenses about 1 oz per pump, so I put 30 pumps in each tire, and the bottle was mostly empty by the time I finished. Typical with any pump dispenser it was also difficult to get the last bit out of the bottle using the pump. It’s been a week now. One tire has lost about 1 PSI, but the other three are still holding exactly where I set them. Considering how badly these tires were damaged, I’m impressed so far. This is the first time I’ve gone more than a day without dealing with flats in that field.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
D
Verified Purchase
Duncan Souza
Grantham, US
★★★★★ 4
Pump is worthless
Size: 1 Gallon + Tool, Set name: Small Tire/Bicycle Formula
The sealant is good. The gallon pump is a joke. Pump stopped working 4 pumps in. Went and got another replacement pump from automotive store, also broke after 4 pumps. Ended up cleaning out an old Slime bottle and pouring in the flat out sealant in the slime bottle, so I could actually get it in my tires.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026

recommand products