SKU: 74098051915

Cyclophilin A His Tag Protein, Human

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cyclophilin A His Tag Protein, HumanProduct Specification Species Human Antigen Cyclophilin A Synonyms Peptidyl prolyl cis trans isomerase A, PPIase A, Cyclosporin A binding protein, Rotamase A Accession P62937 Amino Acid Sequence Met1 Glu165, with C terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH Expression System E. coli Molecular Weight 20kDa

Product Specification


Species Human
Antigen Cyclophilin A
Synonyms Peptidyl-prolyl cis-trans isomerase A, PPIase A, Cyclosporin A-binding protein, Rotamase A
Accession P62937
Amino Acid Sequence

Met1-Glu165, with C-terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH

Expression System E.coli
Molecular Weight 20kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris,250mM NaCl, pH 6.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cell Death Dis. 2013 Oct 31;4(10):e888.
2. Biochemistry (Mosc). 2022 Mar;87(3):259-268.

Background

Cyclophilin A (CyPA, 18 kDa) is a ubiquitously distributed protein belonging to the immunophilin family. Cyclophilin A (CyPA) is a peptidyl-prolyl cis-trans isomerase that exists in the intracellular and secretory forms and has multiple functions. Intracellular CypA takes part in folding, transport, and assembly of proteins; regulates cell proliferation; is a ligand for cyclosporine A (CsA), mediating its immune-suppressive activity; mediates signal transduction from a T cell receptor, and controls the balance of T helpers 1 and 2, inhibiting activity of T helpers 2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74098051915

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Bill Moses
Bozeman, US
★★★★★ 5
Portable Crown Cigar Tube: A Handy Travel Companion
Color: RYLCC-GLD, Color: RYLCC-GLD
The wanbro Crown Cigar Tube is a must-have for cigar enthusiasts on the go. Made from durable aluminum alloy, it provides excellent protection for your cigars while you travel. With built-in features like a cigar holder, punch, and ashtray, it's a convenient all-in-one solution. Plus, its smell-proof design ensures that your cigars stay fresh wherever you go. Overall, it's a practical and stylish accessory that makes a great gift for any cigar lover.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2024
M
me
Dallas, US
★★★★★ 5
Excellent Cigar Tube!
Color: RYLCC-BLK
This impressive cigar carrier is a complete and safe way to carry one cigar. This holder is light aluminum; you can throw it in a range bag, backpack, or any other carrier without worry. This carrier has a punch for your cigar and a built-in cigar stand. I love my cigar carrier; I have just enough capacity to enjoy my cigar.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 29, 2023
R
Verified Purchase
ray
Grantham, US
★★★★★ 3
Picture is misleading
Color: RYLCC-BLK
Great product! Good quality! The picture of the product is a little misleading as it looks like there are 2 tubes instead of one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2024
C
Verified Purchase
Charles Stein
Waukegan, US
★★★★★ 5
Perfect sized wrist-rest!
Size: Compact, Size: Compact
Great wrist-rest! Very squishy and feels comfortable & cool even after hours at the computer. The rubber gripper bottom is effective & it never shifts around for me. Also, love that it fits the length of my 75% keyboard & my boyfriends 60% Wooting 60HE keyboard perfectly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
S
Verified Purchase
Sandra Miller
Lake Worth, US
★★★★★ 5
Very Pleased!
Size: Full Size
Review for: Cooling Gel Wrist Rest Pad -Full Size 18"- Memory Foam Palm Rest with Non-Slip Footpad - Ergonomic Design Wrist Support - Desk Keyboard Accessory Gaming Gear (Large-Full Size). I've had this for a week and I'm impressed! There is no skimping on quality, which is rare nowadays. It is made extremely well, solid yet soft. I love the feel of the outer cover. It's comfortable and stays in place. And let me add... I'm putting it to the test. I have a rolling over-bed/couch desk. It has a raised 1/4" lip around the top. I put this wrist-rest on top of that lip. So far there's not any wear across the bottom of this wrist-rest. And that's with me using it for my wrists... and my elbows. It far surpasses the last rest I bought. From my experience, many sellers slap the phrase "memory foam" on their products when they are not. That's NOT the case here. This rest immediately bounces back to its original shape. It's true memory foam! It's so comfortable that I forget it's there yet I enjoy the comfort immensely. Also, it has no smell. ***From my experience so far... I highly recommend this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2024

recommand products