SKU: 78373514040

Human CD47, His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 10 - Sep 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD47, His tagProduct Specification Species Human Synonyms Antigenic surface determinant protein OA3, Integrin associated protein (IAP), Protein MER6 Accession Q08722 Amino Acid Sequence Protein sequence(Q08722, Gln19 Glu141, with C 10*His) QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 6kDa Actual: 30 45kDa Purity

Product Specification


Species Human
Synonyms Antigenic surface determinant protein OA3, Integrin-associated protein (IAP), Protein MER6
Accession Q08722
Amino Acid Sequence

Protein sequence(Q08722, Gln19-Glu141, with C-10*His) QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:15.6kDa Actual:30-45kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD47 (Cluster of Differentiation 47) also known as integrin associated protein (IAP) is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily[5] and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPα). CD-47 acts as a don't eat me signal to macrophages of the immune system which has made it a potential therapeutic target in some cancers, and more recently, for the treatment of pulmonary fibrosis. CD47 is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. Furthermore, it plays a key role in immune and angiogenic responses. CD47 is ubiquitously expressed in human cells and has been found to be overexpressed in many different tumor cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78373514040

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gregory James Walker
Lexington, US
★★★★★ 5
Excellent shoes.
Size: 11, Color: Black
Exceptionally comfortable and stylish. Great with casual slacks or jeans. If you have a casual work space or casual Fridays, these will be great. Good support. Good fit. Sizes are accurate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
L
Verified Purchase
lgutz57
Cuba, US
★★★★★ 5
Nice shoe, sizing information on this review
Size: 9, Color: Grey, Size: 9, Color: Grey
Ok, let's talk Breeze Mesh Sneakers by Bruno Marc (Grey)...... Firstly, they are nicely stylish appearance wise. They are lightweight (which I like). They feel comfortable and easy to walk in. I have not owned them very long, so I can't inform you on long term wear or how they feel after months of use. I own many pairs of shoes, mostly running type shoes. I needed a pair like these to wear in a more formal situation. Maybe with some dress pants or nice jeans. Now let's discuss the SIZING which is very important to me. Without a good fit, your shoes will never feel right when wearing. I normally wear size 9 in Men's. I seen someone mention that they 'run small'. I can do 9.5 in those situations, so I ordered 9.5. When they arrived and I tried them on, it was obvious they were too big. too much toe room in front. So I returned them for my normal size which is 9 Men's. Much better. AND, i still have toe room in front (no tightness). My suggestion to you is to order your normal size. The shoes feel like quality shoes and I feel that are a good purchase (for the price). The shoes came quickly. Bruno Marc is a good overall shoe. Hope this information helps.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
S
Verified Purchase
Sean Farley
Houston, US
★★★★★ 4
These shoes adequately do the job they're meant to do
Size: 11, Color: Black, Size: 11, Color: Black
For shoes to wear daily for work, these are absolutely perfect. I give four stars simply because they are not 100% perfect; that is, they are a reflection of their cost and durability. With that said, these shoes are perfect for my role as a professor AND a person who walks half a mile from the train station to class and back 5x a week. Comfortable. Nice cushion on the heel. And they look really amazing - classy but not pretentious. I bought a second pair a week after the first just so I could have different colors, and it is likely I will get a third pair. For $40-ish dollars, they do the job they're meant to and they do it well. This picture shown are the originals I bought, but I also got the black pair, too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
F
Verified Purchase
FTL
Draper, US
★★★★★ 5
Great shoes
Size: 10.5, Color: Dark Grey
I saw people wearing shoes like this in the office (maybe not the same brand), so I ordered a pair to see how they feel. They feel amazing. It's basically sneaker that look ok to be worn with pants and sport jacket. Fit is great, I ordered my usual size and they fit nicely. Sole is thick enough to make them comfortable, not too thick to looks like a sport sneaker. Durability seems ok, wore them couple of times, so I can't really tell, but they seems like they can last long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
K
Verified Purchase
Ken
Fort Morgan, US
★★★★★ 5
Love these shoes
Size: 9.5, Color: Grey
These shoes are soft, comfy, and easy on and off. They breathe in the summer heat and feel good on a cool evening. They run true to size and the colors are like they are represented. I recommend this brand for a good looking, inexpensive shoe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026

recommand products