SKU: 78728017620

Mouse CD62L, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD62L, his tagProduct Specification Species Mouse Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, Lymphocyte antigen 22 (Ly 22), Lymphocyte surface MEL 14 antigen, Lnhr, Ly 22, Ly22 Accession P18337 Amino Acid Sequence Protein sequence (P18337, Trp39 Asn332, with C 10*His)

Product Specification


Species Mouse
Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, Lymphocyte antigen 22 (Ly-22), Lymphocyte surface MEL-14 antigen, Lnhr, Ly-22, Ly22
Accession P18337
Amino Acid Sequence

Protein sequence (P18337, Trp39-Asn332, with C-10*His) WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 34.8 kDa Observed MW: 50-60 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. It is coded for in the human by the SELL gene. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. In addition to its function in the immune response, L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78728017620

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lambee
Alexandria, US
★★★★★ 5
No sunburns here!
Size: 6 Fl Oz (Pack of 2)
I love that this is a two pack. I keep one at the house near our entry way and the other goes out with us. Easy to apply, does not streak or leave white residue. Kept my son protected through humidity and heat in Cabo! I would def buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 15, 2025
L
Verified Purchase
LoveSomeBunny
Lowell, US
★★★★★ 5
Gentle, no-tears formula with great sun protection
Size: 6 Fl Oz (Pack of 2)
I’ve tried tons of mineral and chemical face sunscreens. Most all burn my facial skin, especially my eyelids—and make my eyes sting, too. This one, however, lives up to its “tear free” label claim beautifully. No stinging or burning whatsoever. I can wear it for the entire day with no problems. It absorbs very well into a matte finish and does not leave a cast. Feels moisturizing but not sticky on the skin. It’s creamy, but not so thick that it’s difficult to spread. And the price is a fraction of the price of many other sunscreens. I love everything about it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2022
L
Verified Purchase
Laurie Moore
Waukegan, US
★★★★★ 4
Good sun protection
Size: 6 Fl Oz (Pack of 2)
Works! A bit white tint but does work and you know when you need to reapply
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2025
Z
Verified Purchase
Zippy
Louisville, US
★★★★★ 5
Great sunblock, so enjoy the sun!
Size: 6 Fl Oz (Pack of 2)
This sunblock blocks it all and hasn’t any harsh chemicals, meaning it is safe for your baby and for the tenderest of skin. Blocks very well. Easy to use. No harsh scent. I purchased two for our family.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 1, 2024
D
Verified Purchase
Divulge
Omaha, US
★★★★★ 5
Love this product
Size: 6 Fl Oz (Pack of 2)
Love this product. The only product I would use on my face
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2026

recommand products