SKU: 961189109

Human Neurogranin Protein, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Neurogranin Protein, hFc tagProduct Specification Species Human Synonyms Ng, RC3, NRGN Accession Q92686 Amino Acid Sequence Protein sequence (Q92686, Met1 Asp78, with C hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Expression System HEK293 Molecular Weight Predicted MW: 34. 5 kDa Observed MW: 43 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag with C hFc tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Ng, RC3, NRGN
Accession Q92686
Amino Acid Sequence

Protein sequence (Q92686, Met1-Asp78, with C-hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Expression System HEK293
Molecular Weight Predicted MW: 34.5 kDa Observed MW: 43 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Neurogranin is a small, acidic protein that is highly expressed in the central nervous system, particularly in neurons. It plays a pivotal role in synaptic plasticity, which is fundamental for learning and memory processes. Located in the postsynaptic density of excitatory synapses, Neurogranin binds to calmodulin. This binding is calcium - dependent. When intracellular calcium levels rise in response to neuronal activity, calcium - calmodulin complexes form. Neurogranin's interaction with calmodulin then modulates the activity of protein kinase C (PKC), an enzyme involved in signal transduction pathways. By regulating PKC, Neurogranin influences the phosphorylation of various synaptic proteins. This, in turn, impacts the structure and function of synapses, allowing for the strengthening or weakening of synaptic connections, essential for encoding and retrieving information in the brain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 961189109

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Suleyka Torres
Battle Creek, US
★★★★★ 5
Me encanta
Color: Glint Rainbow
Me encanto volveria a comprar
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
Y
Verified Purchase
Yss
Alexandria, US
★★★★★ 5
better results
Color: Glint Pink
I really like the packaging; you don't need to open it and spill everything—with a simple touch, you have the product. I love it and would buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
S
Shelby
Bozeman, US
★★★★★ 2
Not very much dispenses with pumps
Color: Glint Rainbow
This gives out very small puffs of glitter when depressing the pump. The glitter is as expected, but it would be more efficient to just open the dispenser with how little this pumps out. I'll probably just use this for crafts instead of body and hair. It doesnt really stick either because it is a dry powder
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
T
Verified Purchase
Takelia
Charlottesville, US
★★★★★ 1
Not what I expected
Color: Glint Rainbow
Product doesn’t come out like a dust
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
P
Power Adapter
Natrona Heights, US
★★★★★ 4
Fine, dry glitter in a puff spray bottle
Color: Glint Rainbow
This works well if, and only if, you know exactly what it is and if it'll work for your application. This glitter comes with no adhesive or stickiness in it. It is not like a glitter stick, or glitter makeup. It is dry glitter in a spray bottle. The spray pattern is very narrow, so if you want to spray it onto a piece of paper or you body, it will show up in a clump. It does not have an airy spray pattern. To use this, you need to add some stickiness to the surface you want it to stick to first. Something like glue on paper or some sort of sticky thing on your skin that won't sink in. If regular lotion sinks in, the glitter will just fall off. So petroleum jelly or something that sits on top works best. Also, if you want it spread out instead of in little clumps as it comes out of the spray bottle, you'll have to move it around manually. On some level, to be entirely honest, I'm not sure this application method is better than loose glitter. With loose glitter, at least I can manually sprinkle it and not get a giant blob like with the spray. Also, some little bits get loose with the spray, and loose glitter in a house is just asking for forever glitter. I'm deducting one star simply because the spray delivery mechanism isn't very useful, and can actually be a liability. Unlike some spray glitters with propellant and adhesive that are more like spray paint and have a more spray paint application profile. This manual puff method just doesn't work well with glitter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026

recommand products