SKU: 98332693076

Human papillomavirus type 16 E7, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7, his tagProduct Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98, with C 10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 7 kDa Observed MW: 16, 20 kDa Purity 90% by SDS PAGE Endotoxin <1EU g Tag His Tag, with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98, with C-10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.7 kDa Observed MW: 16, 20 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag, with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins, and only the high-risk HPV E6 proteins form detectable complexes with p53 in vitro.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 98332693076

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Akino
Chelsea, US
★★★★★ 4
Great Suit, Fits Good and Very Comfy
Color: Navy, Size: 44, Color: Navy, Size: 44
I bought the MOGU Suit 2 piece slim fit suit kinda last minute for an event, and honestly I was suprised by how good it came out. The quality is better than I expected for the price. The fabric feels smooth and not cheap or itchy. The fit was pretty good overall. The jacket sits nice on the shoulders and the sleeves lenght was just a little bit longer than I like, but not a big deal. The pants fit slim but not tight, so I could move around without feeling uncomfortable. I think the sizing is mostly true, but if you're between sizes go up one. The stitching was actually clean and neat. I checked the seams because I’ve had suits before where threads be sticking out everywhere, but this one was solid. No loose ends, no weird cuts. Comfort wise, it’s suprisinly good. I wore it for hours and it didn’t feel heavy or rough. The one-button blazer gives it a nice modern look too. Overall, good buy for the money. Not a high-end designer suit, but for the price range it’s really good and looks way more expensive than it is. I’d definetly order again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 5
Nice suit
Color: White, Size: 32
Nice suit, too small for my teenager
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
T
Verified Purchase
Thuhuong N.
Omaha, US
★★★★★ 5
Comfortable
Color: Black, Size: 30
My son love the fits and colors. Great quality and the very little stretchiness. No wrinkles at all . Feel very comfortable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
C
Verified Purchase
CJ Demas
Waukegan, US
★★★★★ 1
Just basted together
Color: Orange, Size: 30, Color: Orange, Size: 30
At first, I was super excited and thought it was a fantastic deal. I bought this suit for a work event, and got it a few days early. I tried it on, everything fit well, I loved the fabric, nothing was tight at all but neither was it loose. Then, I wear it to work. I even took a picture before heading off to work, where everything was still perfectly out together and no issues were visible. And then I sit down at work to eat my breakfast, and notice that stitching RIGHT OVER MY CROTCH had come loose and made a hole. Not popped, the stitching was not broken or anything, but just unraveled. Nothing was tight, and sitting down and walking felt normal so I know I didn’t strain the fabric at all. The stitches were just loose, and the thread was all over the place. Luckily I don’t think anyone saw, I was able to keep my legs crossed or cover the problem area strategically with my water jug or bag. But my house is an hour’s drive away from my work, so I couldn’t just go back and change. I had to borrow a stapler and STAPLE THE HOLE SHUT. Yes, lesson learned, I bought several emergency sewing kits that I will stuff in everything I carry with me everywhere in case something like this happens again, but still. It was BRAND NEW. Not only that, but as I was in the restroom stapling my new suit pants back together, I found the issue. The crotch area was just basted together, no backstitch or proper finishing at all. And it continues down the leg, I had to be careful not to bend my legs too much or those seams would also unravel. They already loosened a little bit and risked showing my skin underneath just by walking. I managed to play it off and keep my body posed in such a way that it was unnoticeable, especially with help of the staples, but still! Super embarrassing, especially since I’m in a large training class right now and everyone found out just because I had to ask everyone if they had a sewing kit on them. I was so ready to chock this up as a win, too. Good thing I postponed my review. Sloppy sewing all around really, once I took a moment after getting home to look closer. Some areas are sewn well and finished properly, but others are still only basted shut or the end of the thread wasn’t anchored at all. I’m going to spend a lot of time re-doing the stitches, because I’m too stubborn to send the piece back and I know how to sew better than whatever machine made this anyway so I don’t wanna waste the fabric. Such a disappointment.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2024
D
Verified Purchase
David M Johnson
Whiting, US
★★★★★ 5
I can’t believe the quality for the money
Color: Hot Pink, Size: 38
I am a suit designer for a better priced menswear brand. I bought this suit for a “day-glo” party, so the expectation was going to be one wearing to a party. I wasn’t expecting much for the money, but the color filled the bill. When I received it, I couldn’t believe how great the construction and quality were. The jacket is fully lined, contrast interior piping, interior double welt pockets on both sides, and the fit was really exceptional. The pant had fully taped interior seams, pick stitched curtained waistband, split back seam (so you can easily gave it altered if you need), interior front closure button and tab, hook and eye and exterior button. Note: no one mentioned this, but the waistband is discretely adjustable like a rental tux, so enables fit for a wider range of sizes. The jacket runs true to size, but the pants have some flexibility and are easily altered, so buy your jacket size… that would be harder to alter. The only gripe is the buttons are super cheap looking, and white colored (surprised they weren’t dyed to match, given the rest of the quality).. I’ll be changing them out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2023

recommand products