Pay in installments of $87.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 9 - Sep 14
For Your Every Summer RSVP, with Code: SUMMER15
Description
MDL-1 /CLEC5A His Tag Protein, HumanProduct Specification Species Human Synonyms CLEC5A Accession Q9NY25 Amino Acid Sequence Pro 28 Lys188,with N terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK Expression System HEK293 Molecular Weight 33 45 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | CLEC5A |
| Accession | Q9NY25 |
| Amino Acid Sequence | Pro 28-Lys188,with N-terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK |
| Expression System | HEK293 |
| Molecular Weight | 33-45 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
CLEC5A is a spleen tyrosine kinase (Syk)-coupled C-type lectin that is highly expressed by monocytes, macrophages, neutrophils, and dendritic cells and interacts with virions directly, via terminal fucose and mannose moieties of viral glycans. CLEC5A also binds to N-acetyl glucosamine(GlcNAc) and N-acetylmuramic acid(MurNAc) disaccharides of bacterial cell walls. Compared to other C-type lectins(DC-SIGN and DC-SIGNR) and TLRs, CLEC5A binds its ligands with relatively low affinities. However, CLEC5A forms a multivalent hetero-complex with DC-SIGN and other C-type lectins upon engagement with ligands, and thereby mediates microbe-induced inflammatory responses via activation of Syk. For example, in vivo studies in mouse models have demonstrated that CLEC5A is responsible for flaviviruses-induced hemorrhagic shock and neuroinflammation, and a CLEC5A polymorphism in humans is associated with disease severity following infection with dengue virus. In addition, CLEC5A is co-activated with TLR2 by Listeria and Staphylococcus. Furthermore, CLEC5A-postive myeloid cells are responsible for Concanavilin A-induced aseptic inflammatory reactions. Thus, CLEC5A is apromis-Cuous pattern recognition receptor in myeloid cells and is a potential therapeutic target for attenuation of both septic and aseptic inflammatory reactions.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 25 reviews
Sort
Product Reviews
★★★★★ 5
Cute Basic Tank That’s Easy to Dress Up or Down
Color: Taupe, Size: Small
This ANRABESS sleeveless tank top is a really cute basic to have in the closet. I bought it in 3 colors. I like the fitted ribbed style because it gives it a little more shape than a plain tank, but it’s still simple enough to wear with just about anything.
The scoop neck is flattering without being too low, and the slim fit makes it easy to tuck into jeans, shorts, or wear under a jacket/cardigan. It’s one of those tops that works for everyday outfits but can also be dressed up a little with jewelry or nicer pants.
The material feels comfortable and stretchy, and it has that casual summer look without feeling sloppy. I’d say it’s great for warm weather, layering, or just throwing on when you want something easy but still put-together.
Cute, flattering, and comfortable — a great basic tank that I can see myself wearing a lot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
★★★★★ 5
Great, well-fitting basic!
Color: Beige, Size: Medium
I love, love, love these basic tanks. They fit true to size. They’re really soft and comfortable and they’re such a great value. I have them in at least five or six colors. They look great on their own or under a cardigan.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
★★★★★ 5
Light weight, not thick or bulky, versatile, and perfect!
Color: White, Size: Small
Throw out all the tank tops you own cause this is the only tank top you will need from here on out. It is absolutely perfect. Let’s just say they understood the assignment. It is form fitting and pairs perfectly with lightweight sweaters that might be slightly sheer or even the new crochet type of open sweaters that need a tank underneath. It is the perfect stretch, perfect material and dressy enough to be worn on its own and upgraded with some jewelry and some classy jeans and has just enough sheen to look dressy and not like you’re wearing a workout top. I love , love this and it is my go to tank!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
★★★★★ 5
Comfortable, flattering wardrobe staple
Color: White, Size: Small, Color: White, Size: Small
I’ve tried a lot of basics, and this ANRABESS sleeveless scoop neck tank exceeded expectations. The fabric feels soft and breathable with a nice amount of stretch, and it has a flattering fit without being too tight or restrictive. The scoop neckline is classic and versatile, making it easy to layer or wear on its own. Stitching and construction appear well made, and it held up nicely after washing with no shrinking or loss of shape. Great quality for a basic essential, and a piece I can see reaching for often. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
★★★★★ 4
The length is perfect. Nice and long.
Color: Yellow, Size: X-Large
These tanks are the perfect length. I love how they fit and feel. I bought these in 5 colors. Although, if you want to keep them long, I suggest hanging them to dry. Putting them in the dryer shrinks the length about 2 inches.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026