SKU: 11577532710

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding prtein, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Ala2 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding prtein, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Ala2-Ile250, with C-10*His)
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 27.8kDa Actual: 28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11577532710

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kathryn L Taylor
Charlottesville, US
★★★★★ 4
cotton straw bunny
Color: Buffy - The Bunny​, Size: One Size
its a cute bunny but it not washable due it stuffed with straw so once dirty ill have to toss it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
C
Verified Purchase
Cleopatra Shaw
Battle Creek, US
★★★★★ 5
Coconut Fill FOREVER! 🏆🏆
Color: Buffy - The Bunny​, Size: One Size
The best because it not stuffed with white stuffing, the coconut filling it way better!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
S
Verified Purchase
Shari
Grantham, US
★★★★★ 3
Didn’t last long
Color: Buffy - The Bunny​, Size: One Size
Three stars because I really loved that this was made from 100% cotton and had the coconut fiber fill, it’s almost impossible to find non toxic, natural fabric and fill for dog toys for some illogical reason, but unfortunately, it only lasted a day for my husky. She’s not that hard on her chew toys, so it should’ve lasted. The squeaker was also not what I had hoped for, difficult to get it to squeak. This is a common problem w squeaky dog toys I’m finding. I would love for this company to improve the durability, get better squeakers and become the go-to place for me and other dog owners who understand the importance of all natural chew toys. I would support, be a lifelong customer and recommend to all my fam and friends.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2025
K
Verified Purchase
Kristen I
Los Angeles, US
★★★★★ 5
Perfect for our purpose (Tricks)
Size: Newspaper 4 PCS
Perfect for tricks-related interactions (we have them inside a mailbox our dog opens… then he retrieves the news)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2025
T
Verified Purchase
Tor
Houston, US
★★★★★ 1
Beware of these crinkle plastic filler!
Size: Newspaper 4 PCS
3:09 handed to her.. 3:13 (4 minutes) taken away from her.. chewing on the plastic inner sheet filler... Not good gor medium to larger dogs! Nothing more than a thin satin pillow sheet with crinkle plastic paper inside that can choke your dog if not monitored!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products