SKU: 97937623322

Apolipoprotein A-I/APOA1 Protein His Tag, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apolipoprotein A-I/APOA1 Protein His Tag, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His

Product Specification


Species Human
Synonyms Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1
Accession P02647
Amino Acid Sequence Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
Expression System E.coli
Molecular Weight 29.6 kDa
Purity

>98% by SDS-PAGE and RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 100mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97937623322

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sun Y
Lowell, US
★★★★★ 4
Soft. Flexible. Easy to grab.
Pros: Soft. Durable. Fits. Cons: String durability. This silicone material is soft to the touch and feels great. It is very flexible as well and I expect it to last a long time. The design doesn’t interfere with the touchpad at all when trying to navigate and fast forward or fast reverse. There are top and bottom bumps with extra material that create this gap underneath. It’s such a minor detail but makes grabbing the remote so easy versus having it completely flat. There are cut outs for charging port, IR, Apple logo, and what I think is the microphone. It comes with a sling that gets attached to the cover. It’s an ok sling as over time it did fall apart for me. Granted we don’t really use the string much. You can hang it with the accessory it came with though. We just toss it around. Overall, this is a great case for your remote.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 24, 2020
K
Verified Purchase
Ken Hammond
Belleville, US
★★★★★ 5
Looks like a new remote
Needed something to cover and also protect the remote after dropping it so many times that it was chipped around edge. This looks great and the remote is easier to find and looks like brand new.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2025
B
Verified Purchase
BC
Phoenix, US
★★★★★ 5
Fits Great, Problem Solved !
Great product that gives your Apple TV remote a good feel & look and added protection. Did not need the hand strap or hangers but an added bonus if you do..!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2019
J
Verified Purchase
Jdawnm66
Cuba, US
★★★★★ 5
Perfect Fit!
This silicone fits like a glove and keeps that slippery and fragile Apple remote from slipping right out of your hands. Great value and well made product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2021
T
Verified Purchase
thyroyalreader
Cuba, US
★★★★★ 5
My fave ever
I bought this to travel for a summer camp and still use it, two years later! It is now my everyday jewelry container. The gold clasp has held up well and closes well. Very easy to use and structurally sound! I love the color and overall vibe of it too- very straight forward. I use the top portion for long earrings, so know if you do that, it can be finnicky, if you have fun or funky shaped earrings- so just know they may get caught but it's such an easy fix. I would say it is about the size of half of an American Girl doll. Maybe around the size of half a goose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products