SKU: 13269728637

CD7 Fc Chimera Protein, Mouse

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen CD7 Synonyms CD7, GP40, TP41, LEU 9, Tp40 Accession P50283 Amino Acid Sequence Gln24 Pro150, with C terminal Human IgG1 Fc

Product Specification


Species Mouse
Antigen CD7
Synonyms CD7, GP40, TP41, LEU-9, Tp40
Accession P50283
Amino Acid Sequence

Gln24-Pro150, with C-terminal Human IgG1 Fc QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-54kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Sempowski G D. et al. (1999) Resistance of CD7-deficient mice to lipopolysaccharide-induced shock syndromes. J Exp Med. 189(6): 1011-1016.

Background

CD7 is a 40-kD member of the Ig gene superfamily that is expressed on a major subset of human peripheral T lymphocytes and NK cells. CD7 is an early T cell activation antigen in that CD7 mRNA levels rise within 15 min after initiation of a transmembrane calcium ion flux. CD7 can complex with CD3 and CD45 molecules, and CD7 signaling involves both protein kinase C and protein tyrosine kinase. CD7 has been shown to be a functional signal-transducing molecule on resting NK cells. Antibody cross-linking of NK cell CD7 induced increases in free cytoplasmic calcium, secretion of IFN-γ, NK cell proliferation, adhesion to fibronectin, and NK cytotoxic activity. Although the above studies have demonstrated in vitro roles for CD7 in T and NK cell activation and/or adhesion, relevant functions of CD7 in vivo remain unknown.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13269728637

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Em C
Dallas, US
★★★★★ 5
Sudsy & good smell
Nice mild smell...suds well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
A
Verified Purchase
AT
Whiting, US
★★★★★ 4
Clean ingredients, nice soap overall but doesn’t have the best lather
4-stars because it doesn’t lather great, but all smell good and my skin is happy— good quality overall! Clean ingredients just as advertised. Just as a side note, the loofa bag it comes with is a bit too rough for my skin so I’ve been using a washcloth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 24, 2025
D
Verified Purchase
den Braber
Whiting, US
★★★★★ 1
To fell clean not dirty with this siap
Not a very good soap wouldn't buy it again.very dissatisfied for the price.soap smells like kerosene and barely any suds.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
A
Verified Purchase
Amazon Customer
Pawtucket, US
★★★★★ 5
Great Value
I'm always looking for a deal on hand and body soap. For the price and what you get they're great. A couple of them aren't my favorite smells, but then again, that's the trade off I made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
S
Verified Purchase
SYJ
Natrona Heights, US
★★★★★ 5
"Bowser, those Chinese never did stand a chance." - Marine general O.P. Smith
Format: Hardcover
The signs was already there. To anyone that bothered to look. But prejudice and victory fever had blinded the top brass to what was unfolding on the ground. Luckily for the men on the ground, there was one top brass that saw the signs, and acted on it. That was the overall situation for the men of the 1st Marine division and the 7th Army division in November 1950. While McArthur and his entourage were busying themselves with the planning of victory parades in Tokyo and promoting a 'Home by Christmas' atmosphere to the press, general O. P. Smith was already laying the ground work for what would determine the outcome of the Chosin reservoir campaign. In the surrounding snow covered hills and mountains, a vast number of Chinese soldiers from the 9th Army was being rushed into position to spring the trap that McArthur and Almond was walking into. What followed was a series of battles that was almost as brutal as the weather. I say almost, because the biggest killer of Chinese troops, wasn't American bombs and bullets, but the winter. One of the coldest in Korean history. Accompanied by the howling wind sweeping down from Manchuria and Siberia. Both sides made their share of mistakes. McArthur, for rejecting any intel showing that Chinese troopes were in Korea. General Song Shilun, who's troops had been told American soldiers were 'paper tigers'. As such, the PLA, anticipating a quick and easy victory, withheld winter cloths and issued only 2-3 days worth of rations while ordering their troops to make a 60 mile forced march from the border, across snow covered forests and mountains, to the reservoir. When the order to attack came, the troops were already in the early stages of starvation. Not only did the Marines held their ground, they annihilated the Chinese units. To make matters worse, their primitive means of communication made it impossible to coordinate their attacks. While as the Marines, despite being surrounded, was able to grind the Chinese units down through a combination of Marine Air Wing, combined arms and gung ho spirit. That, and general Smiths precautions allowd both the Marines and the Army units to fight their way out of a calamity caused by the prejudicial ignorance of McArthur and Almond.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026

recommand products