SKU: 15225050559

CD155/PVR His Tag Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD155/PVR His Tag Protein, MouseProduct Specification Species Mouse Synonyms FLJ25946, PVS, TAGE4, HVED, NECL5 Accession Q8K094 Amino Acid Sequence Asp29 Leu348, with C terminal 8*His

Product Specification


Species Mouse
Synonyms FLJ25946, PVS, TAGE4, HVED, NECL5
Accession Q8K094
Amino Acid Sequence

Asp29-Leu348, with C-terminal 8*His DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 50-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Liu Lu ,Wang Ying ,Geng Chen,Wang Aihong ,Han Sai ,You Xuewu ,Sun Yu ,Zhang Junhua ,Lu Wei ,Zhang Youzhong. CD155 Promotes the Progression of Cervical Cancer Cells Through AKT/mTOR and NF-kappa B Pathways. [J] FRONTIERS IN ONCOLOGY.2021-07-05(11).

Background

CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic viro therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15225050559

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
K. White
Natrona Heights, US
★★★★★ 5
Easy to use
Color: Mulberry, Color: Mulberry
I love it. It makes working on it so much easier
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
J
Verified Purchase
Jas
Bozeman, US
★★★★★ 4
Super cute and soft!
Color: Pine Green, Color: Pine Green
I really like this case. I was surprised by how soft it is! It arrived in perfect condition (just like the photos), no smell, keyboard worked. I followed the sellers instructions to charge before use. I gave it one less star because personally don’t care about the keyboard, it’s a little on the slower side when using the mousepad or typing. I didn’t have any issues with connecting. It was an easy setup. I’d suggest you spend the money for a laptop or a true keyboard if you need it. This is more for looks. If it wasn’t for the quality of the case, I’d probably return.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
D
Verified Purchase
Denise Z
Draper, US
★★★★★ 5
Good protection for my ipad
Color: Sky Blue
Flap to close is magnetic, so it stays closed. Has a spot for the open for the ipad. Keyboard is a handy feature to have, and love that it lights up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
O
Verified Purchase
Omar Zapata
Waukegan, US
★★★★★ 3
Case quality is great, but keyboard is disappointing
Color: Mulberry
The quality of the case is really great. Plum color is beautiful. However, the keyboard is not the best quality. The keys are not sensitive enough and you can easily misspell words if you don’t click a key hard enough. The trackpad shortcuts are cool but inconvenient since you can turn off the shortcuts. You can turn off the trackpad but that just doesn’t work for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
T
Verified Purchase
Timothy N.
Massapequa, US
★★★★★ 5
Economically priced ipad case
Color: Mulberry
There's absolutely no way you could find a better ipad case with a wireless keyboard for this price. My daughter loves it. I was expecting it to feel a little cheap because of the price. I was wrong, this is a great find... thanks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026

recommand products