Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 18 - Sep 23
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 1kDa Actual: 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder
Product Specification
| Species | Human |
| Synonyms | Parathormone, Parathyrin |
| Accession | P01270 |
| Amino Acid Sequence | Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.1kDa Actual:12kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 to -70 °C as supplied. 6 months. -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 24 reviews
Sort
Product Reviews
★★★★★ 4
Great diapers, just a couple small issues
Size: Size 4, Unit Count: 150
Size 4 have been super reliable for my baby. They fit well, don’t sag, and handle active movement without leaking. The absorbency is great for daytime and short naps. My only minor complaint is that they can be a bit pricey compared to other brands, and occasionally the tabs feel a little stiff. Still, otherwise it’s a dependable diaper that I would definitely recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2025
★★★★★ 5
Reliable Fit for Bigger ToddlersI’m
Size: Size 7, Unit Count: 88
These diapers are great quality and hold up really well for active toddlers. My son has always had thicker legs, and these have suited him really well without being too tight or causing irritation. He just turned two and is already in a size 7 (almost an 8), so sizing up has definitely been helpful for comfort and better coverage for US. The absorbency is consistent, and they stay in place—overall a very dependable choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
★★★★★ 5
What a wonderful treat, loved by our very fussy dog!
Our very fussy Havanese absolutely LOVES these sticks! I had to find a new product after the USA-made chicken wrapped rawhide sticks were no longer available. It is very difficult to find a quality product made in the USA & while these are made in Cambodia, they seem to be made under very strict standards. I was also impressed that this co. claims it has never had a recall of their products. I also relied on the many, many excellent reviews of past customers. Our Teddy gets a stick every morning & then will wait by the pantry to get an additional 1 or 2 or more throughout the day! He usually does not eat the rawhide, just chews it up a bit. He is in love with these!! He also has a sensitive stomach & these have never bothered him one bit. His teeth are also quite clean from using these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
★★★★★ 5
Great dog treats
My two dogs love these treats.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
★★★★★ 5
Great value
You get so many in the package. My dog gets one each night after dinner as a “tooth brushing”. He’s a big greyhound and these are thin and smallish, which is great for smaller dogs, but he loves them anyway.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026