SKU: 26208199669

Brain Natriuretic Peptide Protein, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 24 - Sep 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Brain Natriuretic Peptide Protein, HumanProduct Specification Species Human Synonyms Brain natriuretic peptide 32, Gamma brain natriuretic peptide, B type Natriuretic Peptide, GC B, BNP 32 Accession P16860 Amino Acid Sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Expression System E. coli Molecular Weight 3. 5 kDa (Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris HCl, 200mM NaCl,

Product Specification


Species Human
Synonyms Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32
Accession P16860
Amino Acid Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Expression System E.coli
Molecular Weight

3.5 kDa (Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 200mM NaCl, pH8.5
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26208199669

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael S
Lowell, US
★★★★★ 5
Great Product that does exactly what it says it will.
Color: Beige, Size: 34"- 3 Panel
I really enjoy this product and it does exactly what it describes. I use it on my balcony. It is effective, but still very lightweight. It is easy to assemble as well. The price point is excellent. Also, I had an interaction with the company about an issue and they were incredibly responsive and helpful, fixing the issue immediately. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
L
Verified Purchase
Lula-A1A
Boise, US
★★★★★ 5
Great WFH screen for video calls
Color: Black, Size: 22"- 4 Panel
I share a workspace with my hubs since we both work from home. I have the attention span of a 🐿️ and need this so I can focus on my work and not get distracted by him, since he is very amusing to watch. This screen is very lightweight and the panels can move and create a little cubicle around your workspace. I personally loved cubicles & despise open space seating, even at home. The ADHDer in my loves being able to block things away from my field of vision. These panels also hide any mess behind you, especially if you forget to blur the background on Teams or Zoom calls or if you don’t have the option to change your backgrounds. This was fairly easy to put together and very easy to move and adjust. The screen is a much better option than a sheet as I’ve seen others use on calls.🤦🏻‍♀️😂 I’m not sure how it will stand up around rambunctious pets or kids, but fairly certain it takes quite a push to knock it over. We have four cats & I’m pretty sure someone would try to climb this, which is why they’re not allowed in our workspace.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2025
A
Verified Purchase
Aidan
Charlottesville, US
★★★★★ 4
Difficult to assemble, but a good basic divider
Color: Beige, Size: 22"- 4 Panel
I bought this to use as a background for when I have video calls. I wish I'd ordered the 6- or even 8-panel to block a little more, but that's my own error. It still covers a good portion of the room, so I'll make do, or maybe buy another at a later date to expand it. It looks ok, if a little plain. The fabric panels have creases in them from being folded and will need to be steamed or ironed out for a nicer look. It would be easy to make your own panels as well, if you're so inclined. The construction is decent. The frame is lightweight and if you don't angle the base supports the right way it may tip over if you extend it too far. The fabric panels aren't the highest quality, but are sturdy enough. They seem like they would handle being thrown in the wash well. The only issue I have with it is that it was so difficult to put together. The push latches that connect the poles don't push it well and hurt my hands. The fabric panels are sized to be extremely taut, which makes it very difficult to get them on the bars without forcing the bar to bend slightly. Overall, this is a good divider if you're looking for something simple and functional without being too worried about aesthetic. It's also a good, inexpensive base if you want to make your own custom panels.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
D
Verified Purchase
DollarBill
Omaha, US
★★★★★ 5
Great Room divider
Color: Beige, Size: 34"- 3 Panel
Works well in separating my kids play area from my computer/office room. Easy to put together, height is perfect somewhat sturdy, looks great, light weight, not good if you are using it as a door, but if it is to stay in place than it is stable enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025
Z
Verified Purchase
zakah123
Lowell, US
★★★★★ 5
Exactly what I needed
Color: Black, Size: 34"- 3 Panel, Color: Black, Size: 34"- 3 Panel
It was easy to put together even without a power drill. Completely opaque. Only a very small slit between poles. I plan to add black electrical tape, but that's because I don't want nosies peeking through to see my screen. The height is beautiful. I was afraid it wouldn't be as tall as I needed. But it is perfect. I share a small office with a good buddy of mine. People passing by our door is distracting and invites them to speak to me. I needed something that would stop the former and prevent the latter, especially when I'm deep in concentration mode. The two panels are enough to block outsiders and the third panel I will employ when I can't even be disturbed by my officemate. It's the fastest and easiest signal not to disrupt me at all. 10/10
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 3, 2025

recommand products