SKU: 30465598465

LILRA2 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA2 His Tag Protein, HumanProduct Specification Species Human Synonyms CD85H,LIR7 Accession Q8N149 1 Amino Acid Sequence Gly24 Asn449, with C terminal 8*His

Product Specification


Species Human
Synonyms CD85H,LIR7
Accession Q8N149-1
Amino Acid Sequence

Gly24-Asn449, with C-terminal 8*His GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

70-90kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. LILRs includes activating (LILRA1, LILRA2, LILRA3) and inhibitory (LILRB1, LILRB2, LILRB3, LILRB4, LILRB5) isoforms. LILRA2, also known as CD85H and LIR7 (Leukocyte immunoglobulin-like receptor 7), is expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses innate immune response. It consists of 2-4 extracellular Ig-like domains, a transmembrane domain (TM), and a short cytoplasmic tail. LILRA2 contains 4 Ig-like C2 type domains in the extracellular region. LILRA2 was recently reported to bind to other unique ligands, the bacterially degraded Igs (N-truncated Igs), for the activation of immune cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 30465598465

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chris H
Natrona Heights, US
★★★★★ 4
3 piece suit at a great price
Size: Small, Color: Black
My son needed a suit, and these worked out great. It looks nice. Don't just assume the size, go by their size chart. I was going to order him a medium, by the chart recommended a small, and it fit perfect. The material doesn't look like an expensive suit but it worked out great for him.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
M
Verified Purchase
Mena
Carnegie, US
★★★★★ 5
Fits so good and looks really niceeee
Size: Small, Color: White
Really nice suit. Looks super nice and high quality. Would purchase again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
A
Verified Purchase
Austin Bradshaw
Massapequa, US
★★★★★ 5
10/10 Great suit , great price
Size: X-Small, Color: Red, Size: X-Small, Color: Red
Absolutely stunning for the price. Very flexible and good fit. I wish the XS was just a bit smaller but it's good. Middle of the ground with thickness it's not a cheap thing costume feel but it's not your typical heavy suit. Which I much prefer. It's lightweight but not cheap. For the price you can't ask for a better suit. I was thinking it was more of a one time use, but it's a very good long term suit. Feels very well and allows great mobility. I featherweight conceal carry and it's very easy to hide my pistol in the suit because of its flexibility. 10/10 would definitely recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
K
Verified Purchase
Kindle Customer
Belleville, US
★★★★★ 5
Good Suit
Size: X-Small, Color: Black
This suit is pretty nice. The fabric isn't extremely thin and cheap-feeling, and it fits really well. The shipping was really fast too. My son is 5'9" and weighs about 150 lbs. We ordered a medium first, but it was too big, so we returned it and ordered an extra small. The extra small fits perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
M
Verified Purchase
Maggie Etheridge
Cuba, US
★★★★★ 4
It's a fun/unusual color, but not "celery"
Size: Medium, Color: Celery Green, Size: Medium, Color: Celery Green
Can't comment on the fit because we didn't take it out of the bag. I gave it 4 stars because 𝙦𝙪𝙖𝙡𝙞𝙩𝙮 of the suit looks really nice through the plackaging, but we didn't open it up and try it on because the color could not be further from what we were expecting. It's actually a really cool and unusual fun fabric, but not really describable as any shade of green which is what I was going for. It's more of a beige tweed whose tiny plaid upon careful examination even has slightly blue threads.. or is that lavender? In fairness to the manufacturer, I tried and tried to get a photo with lighting that accurately represents this fun and unusual color to no avail. For a proper review I guess I should have my son put it on and take a picture in daylight. But they do need to change the color name at least to "champagne tweed" or something. No idea whose job it was to call this color "celery". ;p
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026

recommand products