SKU: 56511678995

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56511678995

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Penny Sinclair
Waukegan, US
★★★★★ 1
Don't waste your money!!
Size: 5 Inch, Color: Fox
With in minutes my puppy was pulling on the middle fiber stuff. I was worried he would choke/ingest it so I immediately threw it away just like the money I apparently threw away on this unsafe and misleading chew toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
H
Verified Purchase
Henry
Houston, US
★★★★★ 5
Very Nice squeaky toys!!
Size: For Medium and Large Breed, Color: 6 Pack
6 in a pack, very cute looking, my 10month golden retriever gnawed off the tail of one in 10min. Then took a while to chew open the head and take out the squeaker. He was given 2 toys so far and in both he gnawed open the head and removed the squeakers. The brown one looked like a real dead animal that was run over by a car.. flat body and busted open head.. gruesome! inside the body is a sheet of sturdy plastic that makes a crinkle sound. Overall very good, wont last long if you have a dog that likes to chew.. but at least there are 6 of them. watch out for ripping off tails or feet.. those are ALWAYS weak points on all of these stuffed/nontsuffed animal toys and can be swallowed. They should just make an oval and have the feet an tail drawn on. also watch out for when they open the head.. the squeaker can easily be swallowed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2025
J
Verified Purchase
Jennifer
Massapequa, US
★★★★★ 5
My dog LOVES to destroy these
Size: For Medium and Large Breed, Color: 6 Pack, Size: For Medium and Large Breed, Color: 6 Pack
I have a black lab/pitbull mix. She is a very destructive puppy when it comes to her toys. I have tried the "indestructible" toys but they were never indestructible enough and my pup didn't enjoy them. But these... lol. When she gets a new one from the box she loves playing tug of war, playing with the squeakers in the head and the tail (to a nauseating degree), and proudly prances around with her new toy to show everyone. But once that phase passes she gets down to business, tearing at it until she gets the squeakers and crinkly paper out. Thankfully she has no interest in the inner parts of this toy, so once she's done with it I just pick up the squeakers and paper/plastic to throw them out, then it becomes a tug of war toy again until it's time for the "stuffy graveyard". Then we start all over again with a new one (the lifespan is between 3 to 14 days). I've purchased this product 7 times already and will continue to purchase more as long as my doggo loves them. If you've made it this far, sadly these toys can be destroyed if you have a power chewer like my pup, but these toys are cheap by comparison to the "indestructible" toys so they are easily replaceable and don't break the bank. These can be great toys for the right dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 23, 2024
J
Verified Purchase
Jodie G
Omaha, US
★★★★★ 4
Well made and great for tug of war with the dogs
Size: For Medium and Large Breed, Color: 3 Pack
The puppies love these toys. I have no idea what the blue one is supposed to be but they are very cute and seem to be holding up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
R
Verified Purchase
RoJo
Lowell, US
★★★★★ 5
Great non stuffed toys. My dogs love them!
Size: For Medium and Large Breed, Color: 3 Pack
My 2 mini schnauzers LOVE these toys! I LOVE them for several reasons. They is no stuffing inside they can rip open and swallow. There is no strings attached to it like other dog toys that my younger schnauzer loves to pull apart and eat. They play tug of war with them, and so far have held up great. They are a squeeke toy, which the dogs love...me, not so much, but I definitely put up with it. Highly recommend these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026

recommand products