SKU: 5474893088

LILRA6/CD85b/ILT8 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA6/CD85b/ILT8 His Tag Protein, HumanProduct Specification Species Human Accession Q6PI73 1 Amino Acid Sequence Gly24 Asn447, with C terminal 8*His

Product Specification


Species Human
Accession Q6PI73-1
Amino Acid Sequence Gly24-Asn447, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 60-7 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

LILRA6, Leukocyte Immunoglobulin-like Receptor subfamily A, member 6, also called CD85b and ILT8.The leukocyte immunoglobulin-like receptor (LILR) multigene family is a family of paired receptors composed of inhibitory and activating forms, which are highly homologous in their extracellular regions and different in their intracellular regions. LILRA6 is the activating forms, which have two or four Ig-like domains with short cytoplasmic tail and associate with FcRγ chain containing immunoreceptor tyrosine-based activation motifs. LILRA6 (ILT8/CD85b) and LILRB3 (ILT5/CD85a) are paired receptors expressed by myelomonocytic leukocytes. LILRA6 and LILRB3 have high similarity in their extracellular domain, making them further difficult to distinguish., and mAbs generated against these receptors bind to neutrophils. In addition, LILRA6 is correlated with susceptibility to atopic dermatitis. LILRA6 on the surface of macrophages induces and regulates cytokines such as IL-4, IL-10, IL-17, TNFα and IFN-γ.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5474893088

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Al Tompkins
Louisville, US
★★★★★ 5
if you are going to be moving them a lot, buy something more sturdy.
Color: Black, Size: Wheel-6 Panel
I use these at our churchc. They are pretty good, not terribly study and the screw that hold the faabric have pulled out in a couple of places. But they wqould work especially well if you were not constantly moving them as we do. They are a bit of a pain to assemble.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2026
J
Verified Purchase
Julie Lincoln
Draper, US
★★★★★ 4
Easy to put together , decent quality
Color: Black, Size: Wheel-6 Panel
Purchased for office, easy to put together , durable quality , exactly what we needed to partition a small space
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Nice and sturdy
Color: Grey, Size: Wheel-8 Panel
Good privacy wall
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
S
Verified Purchase
Steven J.
New York, US
★★★★★ 1
Super Low Quality/Unacceptable QC
Color: Black, Size: Wheel-6 Panel
I spent probably about an hour putting it together, only to take it right back apart and pack it up to return. The dimples for half the poles were on the wrong side (double and triple checked to make sure they couldn't be spun around. The threaded ends for the wheels were freely spinning on all but 2 wheels, making it impossible to actually tighten them fully. Once it was all put together, the screens could not be folded up to neatly put it aside when not in use. All in all, this was shamefully low quality for the money spent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2024
M
Verified Purchase
Miriam Avila Sanchez
Natrona Heights, US
★★★★★ 5
Needed for Sunday School
Color: Grey, Size: Wheel-6 Panel
This was purchase to divide two Sunday school children classes. It works wonderful, big enough, sturdy and with wheels, so is easy to move. Thanks God we can find everything in amazon.com. Delivery was fast and perfect. Thank you .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2024

recommand products