SKU: 47438163423

Human IL-19, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 18 - Sep 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-19, His tagProduct Specification Species Human Synonyms Melanoma differentiation associated protein like protein, NG. 1, ZMDA1 Accession Q9UHD0 Amino Acid Sequence Protein sequence(Q9UHD0, Leu25 Ala177, with C 10*His) LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 19. 5kDa Actual: 29kDa

Product Specification


Species Human
Synonyms Melanoma differentiation-associated protein-like protein, NG.1, ZMDA1
Accession Q9UHD0
Amino Acid Sequence

Protein sequence(Q9UHD0, Leu25-Ala177, with C-10*His)
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 19.5kDa Actual: 29kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Interleukin 19 (IL-19) is an immunosuppressive protein that belongs to the IL-10 cytokine subfamily. The IL-19 protein is composed of 159 amino acids and has a quaternary structure with alpha helix motifs and loops. IL-19 is preferentially expressed in monocytes, macrophages, and T and B lymphocytes, but interacts with immune cells (macrophages, T cells, B cells) and non-immune cells (endothelial cells and brain resident glial cells, etc). IL-19 is associated with broad functions across inflammation, cell development, viral responses, and lipid metabolism. As an immunosuppressive cytokine, IL-19 promotes the Th2 (regulatory) T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and inflammatory cytokine secretion (IFNγ), increases IL-10 (anti-inflammatory) expression in peripheral blood mononuclear cells (PBMC), and inhibits the production of immunoglobulin G (IgG) from B cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47438163423

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jacqueline Coffey
Lexington, US
★★★★★ 5
Worth the price
Color: 35 - Lavender, Size: King
The best thing about these king-size sheets is the deep pockets—they stay securely in place and fit the mattress perfectly. They wash beautifully, resist wrinkles, and are incredibly soft and comfortable. A great combination of quality, comfort, and convenience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
J
Verified Purchase
Judy L.
Houston, US
★★★★★ 5
Get the best sleep ever - soft, stay cool, don't wrinkle or pill after washing, and stay on.
Color: 25 - Burgundy, Size: Full
Prior to buying this set of sheets, I tried just the pillow cases. I had a more expensive set of Egyptian cotton sheets and pillow cases, but every night I had to flip the pillow because it was too warm even when the room was cool. I bought the pillow cases for both my husband and myself, and we both saw an immediate improvement in our Samsung watch sleep scores. The pillow cases were so soft and I no longer woke up during the night with my head being too warm. The sheets I had been using were supposed to be for thick mattresses, and fit at first. I have a 12 inch mattress, and after a few washings, these sheets wouldn't stay on one corner of the mattress. There was no way I could stretch it over all four corners. Since I was so happy with the pillow cases of this brand, I decided to buy the sheet set. As I normally do, I washed and dried the set before using them. The sheets are every bit as soft and comfortable as the pillow cases, and they were wrinkle free with absolutely no pilling after washing. Putting them on my 12 inch mattress was a breeze. They fit over all the corners and even tucked in on all sides. The sheets are every bit as soft and comfortable as the pillow cases I had bought previously. Since I put them on my bed when warm weather was coming, I put away some of the blankets and comforters I had on my bed for the winter. I found that these sheets, are not quite as warm as my previous heavier sheets. For me this is a good thing as I used to wake up in the night sweating with my PJ's stuck to me. When I pushed down the covers, I would be freezing because my PJ's were wet. Since my bedroom is usually cool, I put some of the blankets back on my bed, but now I don't wake up sweating. Now I can use my blankets without sweating and having to push them to the bottom of the bed during the night, and my sleep score, measured by my Samsung watch, is consistently 10 or more points higher than it was before using these sheets. If you tend to sleep warm, these sheets would be perfect for you. At this point, I very much prefer these sheets over the stiffer, heavier Egyptian cotton sheets that don't breath. I should also mention that I bought the burgundy color that is a true burgundy - not red. UPDATE 7/25/22: I have been using these sheets for almost 1 1/2 years, and they have been washed and dried multiple times. They still look and feel as good as the first time I used them. They have not pilled or shrunk, and still fit on my bed as well as they did when they were new. Although I bought the set for a double bed, the pillow cases are large enough to fit the queen sized pillows I have, and are long enough the enveloping flap on the ends of them is really not needed. I still love this set of sheets, and will likely buy another set. UPDATE 08/10/23: I have been using this set of sheets for about 2 1/2 years, I and I still love them. I have been using only this one set of sheets. I take them off my bed, machine wash and dry them, and put them back on. They have not shrunk, pilled, or faded, and look as good as the day I bought them. I like these so much better than cotton sheets I have had in the past, including Egyptian cotton. They are so soft, not stiff at all. I decided to buy another set in case they stop selling them and thought I would update my review while I was here. I hope this review was helpful for you. I will update my review if my opinion changes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2022
T
Verified Purchase
Tracey Hawkins
Omaha, US
★★★★★ 5
Extra deep queen sheet set 6 piece
Color: 18 - Navy Blue, Size: Queen
These sheets fit my 17" mattress perfectly. They dop pop off even after several days of getting in and out of bed. On occasion they do need to be pulled down. They are a great value for the money, I will be buying more in different colors. I love that they are wrinkle free and so soft. They're great if you have other colors to switch the flat or fitted sheet to create a new look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
K
Verified Purchase
kat1
Phoenix, US
★★★★★ 4
Decent sheet set with truly deep pockets. VERY soft and comfy!
Color: 16 - Light Sage Green, Size: California King, Color: 16 - Light Sage Green, Size: California King
The sheets seem to be of decent quality (maybe a little on the thin side). I ordered the light sage green. They seem to have a bit more of a yellowish tinge than I expected but not too bad. I washed them as soon as they arrived and was dissapointed to see several spots on the fitted sheet. I might have blamed something in the wash cycle but they were washed alone in a clean machine and another reviewer also noted what looked like "oil spots" so I am assuming something during the manufacturing process? The sheets truly do have deep pockets! I have a deep mattress plus a topper and the fitted sheet accomodates well. The set came with 4 pillowcases, which I didn't need but some extras never hurt! I would say examine the sheets before you wash them so you can return them if they have stains. Update* Having slept on these sheets for a few days, I have to say they are extremely soft and comfortable!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
T
Verified Purchase
Teresa Jackson
Cuba, US
★★★★★ 5
Microfiber Has Come a Long Way
Color: 22 - Spa Blue, Size: Queen
I have one of those beds where the head and foot of the bed can be raised or lowered as needed, much like a hospital bed. Except in this case, the mattress is soft but supportive and very thick. If you measure the side from the top edge to the bottom edge of the mattress, it measures a bit over 12 inches. That means, if I want the mattress to actually stay in place it needs to have at least a few inches to tuck under, or it just pulls loose. Many sheets that advertise that they are "deep pocket" sheets often barely go around the mattress, and even clips don't help keep the bottom sheet on. It also means more difficulty in the first place to make the bed if I have to do it myself (I have a "hospital bed" for a reason). I did have two sets of sheets that I loved and were just deep enough to stay on fairly well, but I have had them for several years now, and they have started to get a bit thin in spots and the elastic on the fitted sheet is not as taut as before. Sheets are expensive, but I also have a sensitivity to rough and scratchy material, so the texture had to be something I wouldn't find irritating. The last time I bought "microfiber" sheets was probably when "microfiber" was a new thing, and it usually was some kind of knitted, stretchy material like a t-shirt, but had a tendency to pill badly after a few washings. Still, I needed sheets, and it was winter, and those stretchy knitted sheets were soft and warm, so I ordered two sets of the Extra Deep Queen Sheet Set--one in white, and the other in "spa blue". When they arrived, I was very surprised to see that the quality of the fabric actually mimicked very fine cotton sheets. They were brand new as expected, and they didn't smell or anything, but I do wash things like towels or sheets and some clothing before I use them. They weren't really dirty, so I just washed them in a small amount of detergent and cool water. The directions suggest gentle cycle, but I have a "bulky" setting on my washer that seems gentle enough on sheets but helps avoid issues like the load getting off balance in the tub. I dried it on the low, delicate setting with a sheet of fabric softener to cut down on static and because I wanted a nice scent. The sheets came out beautiful, and have since been used and washed again, and they so far, look and feel even more luxurious than before. I especially appreciate that the manufacturer but a label on the fitted sheet to indicate that the side that was to go on the top/bottom of the mattress. The sheets are VERY deep. More than I require, but now they stay on the bed, no matter how far up or down I move it, or how much I toss and turn. I also bought a set of sheets by another brand, but I really should have just paid the few dollars extra for another set of these. If you are used to those 800-count Egyptian Cotton or those fancy silk and bamboo blend sheets, you're probably going to hate these. But if you ever had to settle for sheets from Dollar General or Walmart, this is going to be a definite upgrade. (My favorite sheets from before I think I ordered online from Sears or Kohl's that were some kind of cotton and synthetic blend. ) Overall, for basic soft, comfortable sheets I can recommend these. They seem to be very warm, so I wonder how "breathable" they would be in the summer, but I tend to be very cold all the time anyway. I love these sheets so far. I'm tempted to order one more set if the other brand ends up being too annoying to deal with.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 26, 2026

recommand products