SKU: 54325598075

FABP6 His Tag, Human

Sale price$193.50 Regular price$215.00
Save 10%

Pay in installments of $53.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP6 His Tag, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms ILeal Lipid-binding protein
Accession P51161
Amino Acid Sequence Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54325598075

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alesialynette
Lake Worth, US
★★★★★ 5
Great plates for the holidays and family gatherings!
Size: Extra Large (Pack of 1), Size: Extra Large (Pack of 1)
These plates are sturdy and designed to hold even the heaviest of meals without bending or folding, which is a huge plus when you're serving barbecue or pasta dishes. One of the standout features is their size; they’re large enough to accommodate generous portions, making them perfect for parties or picnics. I also appreciated the attractive design, which adds a nice touch to the table setting. Cleanup was a breeze, as they are disposable and save me from the hassle of washing up after the event. Additionally, they don’t soak through easily, so I didn’t have to worry about any leaks or messes, even with saucy foods. Overall, I highly recommend Dixie Ultra Large Paper Plates for anyone looking for a reliable and stylish disposable plate option. They combine functionality with aesthetic appeal, making them a perfect choice for any occasion!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2025
S
Verified Purchase
Sw
Boise, US
★★★★★ 4
Sturdy and Reliable Plates for Any Occasion!
Size: Extra Large (Pack of 1)
The Dixie Ultra Large Paper Plates are truly impressive in quality and design. They feel incredibly sturdy, living up to the promise of being 3X stronger than standard paper plates. I love the 11-inch size — it’s perfect for big, heavy, and messy meals without worrying about leaks or spills. The soak-proof coating and microwave-safe feature make them super convenient. The design is also bright and festive without being too flashy. These plates are now a must-have in my kitchen for family dinners and parties!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2025
D
Verified Purchase
Diane Z.
San Leandro, US
★★★★★ 5
Strong Enough for BBQ Ribs, Pasta & Everything in Between!
Size: Extra Large (Pack of 1)
These Dixie Ultra paper plates are truly the heavyweight champs of disposable dinnerware. I grabbed them for a backyard BBQ, expecting the usual paper plate struggle—but these held up like actual dinner plates. We piled on ribs, baked beans, coleslaw, and even mac & cheese, and not a single plate buckled, soaked through, or leaked. At 11 inches, they’re large enough for full meals (and seconds!), and the cut-resistant coating means no forks poking through. They're also microwave-safe, which is great for leftovers. Whether it's dinner with kids, hosting guests, or avoiding dishes during busy weeks—these are now my go-to. Totally worth it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2025
D
Verified Purchase
Douglas E Brandel Jr
Natrona Heights, US
★★★★★ 5
Size and value
Size: Extra Large (Pack of 1)
Much larger than my regular plates and they feel more sturdy than the other plates for the value of the product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
D
Verified Purchase
DC
Boise, US
★★★★★ 5
Durable and cost effective
Size: 100 Pack
Great value for your money. These are sturdy aluminum pans. Also great for cooking-baking in the oven.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025

recommand products