SKU: 60712055584

TNFSF11/RANKL Fc Chimera Protein, Human

Sale price$388.80 Regular price$432.00
Save 10%

Pay in installments of $108.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 23 - Sep 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TNFSF11/RANKL Fc Chimera Protein, HumanProduct Specification Species Human Antigen TNFSF11 RANKL Synonyms RANKL,CD254,TRANCE,OPGL,ODF Accession O14788 2 Amino Acid Sequence Gly63 Asp244, with N terminal Human IgG Fc

Product Specification


Species Human
Antigen TNFSF11/RANKL
Synonyms RANKL,CD254,TRANCE,OPGL,ODF
Accession O14788-2
Amino Acid Sequence

Gly63-Asp244, with N-terminal Human IgG Fc

PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Expression System HEK293
Molecular Weight

55-60kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.O'Brien, C.A. (2010) Bone 46, 911-9.


Background

RANKL (also known as TRANCE or OPGL) is a member of the TNF ligand superfamily. RANKL is produced by T cells, mammary epithelial cells and endothelial cells.  RANKL, through its ability to stimulate osteoclast formation and activity, is a critical mediator of bone resorption and overall bone density. RANK and RANKL are key regulators of bone remodeling and regulate T cell/dendritic cell communications, and lymph node formation.RANK-RANKL signaling not only activates a variety of downstream signaling pathways required for osteoclast development, but crosstalk with other signaling pathways also fine-tunes bone homeostasis both in normal physiology and disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 60712055584

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mark D. Reiners
Dallas, US
★★★★★ 4
Beautiful
Color: All black
Having never previously owned a self-winding watch, and because the wristband did require some link-removal adjustment, I did hold off on wearing it for a few days until I could schedule an appointment with my jeweler to have the day/date setting and band-adjustment done. But a major part of my reason for doing so was my strong impression upon receipt of the watch that this was a very good choice. It is a very beautiful watch to look at, though compact and not overly bulky like many chronograph-style watches, its' heft conveyed a sense of a very solid, well designed and constructed watch. Since having the setting and adjustments done, I have been extremely pleased with how accurately it keeps time. In short, I LOVE this watch. I will also note this. Though my jeweler retails various high-end, and much more expensive watches, he was clearly impressed with the look and feel of this watch, and even made explicit comment about what a beautiful watch he felt it was. That said, I do have a quibble. The writing of the accompanying instruction booklet was riddled with English grammatical errors which were quite frustrating, and contributed to my reason for opting to have my jeweler complete the settings and adjustment. Also, when I contacted OLEV online to solicit guidance on how to expedite registering the purchase for warranty purposes, I received an email auto response saying that any Amazon purchase would require customer service and other guidance through the seller. Since my assumption upon Amazon purchase was that I WAS purchasing from OLEV as the seller, this remains a source of confusion which I yet need to resolve.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2024
P
Verified Purchase
PN
Belleville, US
★★★★★ 1
Doesn’t keep accurate time
Color: All black
I bought this for my husband because it said that it self winds but my husband noticed that it didn’t work within the first few days so I thought maybe it was defective so I purchased another one in exchange for the first one but the second one had the same issue. Don’t waste your money on this, it doesn’t work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025
F
Verified Purchase
Francis Orina
Waukegan, US
★★★★★ 3
Substandard,always donated of time when it works.it had be set on a daily
Color: Black
Stops frequently,sometimes have to give a few days for the clock to start functioning sgain
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
W
Verified Purchase
Whit777
Lexington, US
★★★★★ 5
Awesome watch highly recommend
Color: All black, Color: All black
My husband bought me this brand of watch for my birthday and it’s so awesome. It looks blingy but not in a bad way. Kinda looks like a Rolex. No battery.I bought him a one and he loves it .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 22, 2025
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 5
Solid Trifold Wallet
Color: Two Tone - Cobalt Blue, Color: Two Tone - Cobalt Blue
This wallet is really nice. The stitching looks great and the materials appear to be solid. It’s exactly what I was looking for. It’s a touch smaller than my previous wallet, but that’s not a bad thing as they’re very close. It opens easily and folds back together with no problems. I would definitely recommend this to anyone looking for a solid trifold.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026

recommand products