SKU: 64873679973

ACVR2B Fc Chimera Protein, Human

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ACVR2B Fc Chimera Protein, HumanProduct Specification Species Human Synonyms ACVR2B, Activin Receptor Type 2B, ACTRIIB, MGC116908 Accession Q13705 Amino Acid Sequence Ser19 Thr134, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms ACVR2B, Activin Receptor Type-2B, ACTRIIB, MGC116908
Accession Q13705
Amino Acid Sequence

Ser19-Thr134, with C-terminal Human IgG Fc

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

56-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Attisano L. et al. (1996) Activation of signalling by the activin receptor complex. Mol Cell Biol. 16(3): 1066-1073.

2、Woodruff T K. et al. (1998) Regulation of cellular and system function by activin. Biochem Pharmacol. 55(7): 953-963.

Background

Activin proteins that belong to the transforming growth factor-beta (TGF-β) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 64873679973

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karen G.
Omaha, US
★★★★★ 5
Privacy is Us
Color: Black, Size: 8 Panel
This is a great blocker of the sun and neighbors. It's stylish and can be secured. We used wire above and cinder blocks below. Its sturdy in the wind and rain. We love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2025
G
Verified Purchase
Gloria Garced
Louisville, US
★★★★★ 5
Ideal para espacios pequeños y con estilo
Color: Black, Size: 6 Panel, Color: Black, Size: 6 Panel
Como muchos saben, los apartamentos en Estados Unidos suelen ser pequeños y con poco espacio para guardar cosas. Yo tenía algunas cajas en una esquina que no sabía cómo esconder sin que se viera desordenado hasta que encontré este biombo, y fue justo lo que necesitaba. Me encantó porque además de tapar lo que no quiero que se vea, le da un toque bonito y moderno al área. El color negro combina con todo y se ve elegante sin ser llamativo. Es liviano, fácil de mover y guardar, y lo mejor: no ocupa mucho espacio cuando no lo estás usando. También me sorprendió que se siente firme y bien hecho, no es de esos biombos que se tambalean o se ven frágiles. Ahora tengo más privacidad y orden en casa, sin tener que hacer grandes cambios. Una compra sencilla pero que hace una gran diferencia. ¡Lo recomiendo!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2025
D
Verified Purchase
Dorothy Franks
Battle Creek, US
★★★★★ 5
Easy setup
Color: Black, Size: 8 Panel
Very simple to put up. No assembly required. Just take it out the box and you're done! Also I thought it would be heavy. Very light and easy to move😊
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
B
Verified Purchase
Babs Chapman
West Palm Beach, US
★★★★★ 3
Very flimsy
Color: Beige, Size: 8 Panel
The room divider was OK but a little flimsy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2025
C
Verified Purchase
Cynthia Burris
Pawtucket, US
★★★★★ 5
PERRFECT!!!!!!
Color: Black, Size: 8 Panel
Absolutely LOVE It!!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2025

recommand products