SKU: 74463622606

CDK12/Cyclin K Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 8 - Sep 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CDK12/Cyclin K ProteinProduct Specification Species Human Accession Q9NYV4 1O75909 3 Amino Acid Sequence CDK12: Q696 S1082

Product Specification


Species Human
Accession Q9NYV4-1、O75909-3
Amino Acid Sequence

CDK12: Q696-S1082

QPYKKRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVKNS

Cyclin K:  M1-S300

MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS

Expression System Baculovirus-InsectCells
Molecular Weight CDK12: 61.7 kDa; Cyclin K: 48.1 kDa
Purity >85% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 20 mM reduced glutathione , 1 mM DTT, 0.05% Brij35, 10% glycerol, pH 7.5
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74463622606

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
carolyn
Alexandria, US
★★★★★ 5
Sensitive skin
Such a good product. I use after micro needling when skin is sensitive. Also a great product to use as a barrier serum when starting tretinoin cream.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
L
Verified Purchase
Lindsay
Lexington, US
★★★★★ 5
Saved my skin during an eczema flare up
This saved my skin! I had an eczema flare on my face, and my usual products weren’t working. A friend recommended the Avene brand and within 3 days of using this rescue barrier serum, my flare was almost completely gone! This saved my face!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
B
Verified Purchase
B Helton
New York, US
★★★★★ 1
PLEASE REVIEW — FORMULA CHANGED!!!
I wish I would’ve posted a review PRIOR to the formula changing but just know that I LOVED this serum. I’ve struggled with hormonal acne (PCOS) and eczema for as long as I can remember. Finally, last summer my dermatologist put me on (3) different RX including Spironolactone and Accutane. I was so tired so I stopped everything except for CeraVe cleanser, retinol (Tretinoin) and CeraVe healing ointment. My made up skin routine was working until I used too much Tretinoin and burned my face. I had read great reviews about this product so I thought, I might as well try it — and IT WORKED! I’ve been using this product for almost a year and I loved it. However, 3 weeks ago when I ordered it, I noticed the bottle had a green tint. I could tell after one use that the feel of the serum was different, more watery, not as thick as it used to be. The smell was also different. Still, I kept using it for nearly 2 weeks and I experienced 2 breakouts! Sure enough, I stopped the product and within a few days, my skin was back to normal. I am very upset because as someone who has extremely sensitive skin, this worked but unfortunately, the new formula isn’t for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
N
Verified Purchase
nicolehedge
Cuba, US
★★★★★ 5
Miracle cream
Size: 13.5 Ounce (Pack of 1)
I have been having crazy acne due to a severe reaction to salicylic acid, among other things. My face was incredibly inflamed, itchy, sensitive, red and painful. My dermatologist started me on an oral antibiotic and a clindamycin/benzoyl peroxide topical. The topical was still drying me out quite a bit so I got this lotion and it's literally a miracle cream. My skin is hydrated, no itchy or stinging and the redness has gone down so much. It's also helping my open sores to heal more quickly. Yes, it's a combination of all 3 products working together but I can definitely see and feel the cream repairing my skin barrier. I will be starting on accutane after a month of antibiotics and will continue to use this balm to keep me from drying up like a prune.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
M
Verified Purchase
M. Prieto
Whiting, US
★★★★★ 5
Works amazing! My eczema is clearing up on my face!
Size: 13.5 Ounce (Pack of 1)
I've been struggling with eczema all of my life and I'm insanely sensitive to all sorts of creams. I've tried just about everything you could find. Colloidal oatmeal ones...to hypo allergenic creams in high end stores. I react to goat's milk and even ones with no fragrance. Well, for the first time ever, I found a cream that seems to be doing the trick. I'm on meds to help with the eczema, but the issue was the eye area, upper forehead [between eyebrows], and right under the nose and around the lips. I'd always get this redness and it didn't matter what creams I used. I recently switched to a Clinique soap [more like a moisturizer that comes out of a bottle] for my face, but it still wasn't getting better. It helped, but the redness wasn't going away! I read online about this cream. I don't use a ton. I put literally a drop under each eye and gently tap it into the area. I also just dab a tiny amount on any other red spot. I'm primarily using this for areas where the redness won't go away. Well, three days after starting this my skin is FINALLY healing around my eyes and in the other zones. My mom even noticed! I can tell you, this is a THICK cream. It's too heavy to slather all over your face. Use it to target areas and use a lighter moisturizer [Aveeno has a sensitive face cream that's new and works]. This cream will help the skin heal [all those annoying patches and redness]. It's worth the money. I suspect it's going to take me ages to finish this bottle off. But, it just is so nice to see my face and not have some sort of weird raccoon look. FYI - I do have some patches on my legs which I glob it on and it's helping that heal too. If you need a good hydrating cream that helps protect the skin and helps it get over that bump where it's irritated, this may work for you. Oh, it has absolutely no scent - none. That was a nice surprise. It's designed for sensitive skin. Initially, I was worried about the cost, but now that my eczema is healing up, it's worth every penny. This worked better than all those steroids and hydrocortisone my docs kept giving me. I was so stressed over the wrinkles under my eyes and for once, it's looking nice. :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2023

recommand products