SKU: 86411168073

Human VEGF 121, His Tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 19 - Sep 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 121, His TagProduct Specification Species Human Synonyms Vascular endothelial growth factor A, VEGF A, VPF Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 7kDa Actual: 16,20kDa Purity 95% by SDS PAGE Conjugation Unconjugated

Product Specification


Species Human
Synonyms Vascular endothelial growth factor A, VEGF-A, VPF
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His)


APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 15.7kDa Actual: 16,20kDa

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Vascular endothelial growth factor (VEGF) is a signal protein produced by many cells that stimulates the formation of blood vessels. To be specific, VEGF is a sub-family of growth factors, the platelet-derived growth factor family of cystine-knot growth factors. They are important signaling proteins involved in both vasculogenesis (the de novo formation of the embryonic circulatory system) and angiogenesis (the growth of blood vessels from pre-existing vasculature). VEGF121 is the only form that lacks a basic heparinbinding region and is freely diffusible.  It plays an important role in neurogenesis both in vitro and in vivo (Storkebaum et al.). It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86411168073

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kelly
Natrona Heights, US
★★★★★ 5
Ohhh Mr. Iguana
Size: Medium/Large, Color: Illana the Iguana - Large
Mr. Iguana is a house favorite! I got my first one of these in a barkbox and my dog loved it so much, i went on the hunt for another one. Amazon saved the day! I own about 7 of these now. They are prefect for dogs just love to chew, they hold up great! And they are heavy duty, super easy to clean! My dogs are very happy, great value for the money! Doesn't have a smell, vibrant colors! Noise level is quiet, minus my dogs chewing !
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
S
Verified Purchase
sec682
Cuba, US
★★★★★ 3
Not for strong chewers
Size: Medium/Large, Color: Dog Ness Monster - Large
Initially, I really liked this for my dog. She is about 8 months old and still loves to chew and destroys most toys in a few minutes. When we got this, it seemed like it would hold up for a while despite being clearly gnawed on. Unfortunately, once she focused on the softer "water" portion of the toy, that is where things went downhill with this toy. After a few short chew sessions, she was tearing chunks out of it. We had purchased a replacement since she liked the original so much, and after about 5 minutes with the replacement, she had taken enough out of the blue section that we immediately threw that one out as well. Overall while the green portion held up, the blue didn't. I can't recommend this for strong chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2025
G
Verified Purchase
Gary Hugo
Chelsea, US
★★★★★ 4
Definitely not indestructable
Size: Medium/Large, Color: Dog Ness Monster - Large, Size: Medium/Large, Color: Dog Ness Monster - Large
I have a 1-year-old toy fox terrier (Rocky, pictured). He has been chewing on this toy for seven months now; it is one of his favorites. He has been unable to seriously damage the "ocean" portion of this toy, but as you can see from the provided image, the sea serpent has not faired that well. It is missing its snout and smaller portions of the humps. My guess is that the advertiser images showing much larger dogs with "like new" versions of the toy are just that...NEW AND UNCHEWED. I have not had to clean up bits of this toy from my floor, so I assume Rocky has been swallowing them. My hope is that the yellow material of the serpent is not chemically dangerous when exposed to digestive fluids. Rocky easily destroys plush toys in a matter of days if not hours and, consumed pieces of a small microfiber blanket that he liked to toss around and play tug-of-war with (past tense as he destroyed it and has since been trashed after I began finding feces-stained undigested pieces of it lying around). Since this toy has survived seven months and has remained recognizable, I have to agree it is durable. Just beware, if my small toy fox terrier can damage the toy as pictured, expect your large breed chewer to do similar or worse damage. Also, the toy is very heavy! When Rocky drops it down a flight of stairs, it makes a MAJOR thud at the bottom, and sometimes makes me wonder if it might crack the large tile at the bottom. I cautiously recommend the product. Note the yellow frisbee in Rocky's picture. It is only a few months old and surprisingly has not suffered any chew damage despite substantial abuse. It appears to bend in the wind like a proverbial reed, evading damage by yielding to pressure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2024
E
Verified Purchase
Elaina rice
Los Angeles, US
★★★★★ 5
Dog loves it! For tough chewers for sure
Size: Medium/Large, Color: Dog Ness Monster - Large, Size: Medium/Large, Color: Dog Ness Monster - Large
Dog absolutely loves it, he’s super rough on all of his toys they usually last about 10 minutes bore they are torn to shreds. It’s lasting through his chewing so I’m happy. It’s also super cute.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
M
Verified Purchase
miriana
Los Angeles, US
★★★★★ 5
Loch Yes
Size: Medium/Large, Color: Dog Ness Monster - Large, Size: Medium/Large, Color: Dog Ness Monster - Large
Cute toy, dog really likes it. I had my doubts when I pulled it out, and honestly so did she, but the soft part bounces, so that got her going. We've had it for about a week. My dog is ~70 lbs and a moderate chewer, and this monster still gets regular play and is holding up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026

recommand products