SKU: 97937623322

Apolipoprotein A-I/APOA1 Protein His Tag, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 12 - Sep 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apolipoprotein A-I/APOA1 Protein His Tag, HumanProduct Specification Species Human Synonyms Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1; Apolipoprotein A I, Apo AI, ApoA I, Apolipoprotein A1, APOA1 Accession P02647 Amino Acid Sequence Asp25 Gln267, with N 6*His

Product Specification


Species Human
Synonyms Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1
Accession P02647
Amino Acid Sequence Asp25-Gln267, with N-6*His MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ.
Expression System E.coli
Molecular Weight 29.6 kDa
Purity

>98% by SDS-PAGE and RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 100mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Apolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97937623322

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cece
Omaha, US
★★★★★ 4
Great, but a little big…
Style: Lambchop, Size: 10"
Super soft and cute, I got this for my toy Cavapoo puppy. The different textures are perfect. It is a little bigger than I was expecting, and will probably be about the same size as my puppy when I get her, but I’m sure she’ll love it. I don’t know how safe it will be yet since I’ve yet to be able to watch her play with it, but I don’t see anywhere that could have loose strings for her to choke on, so I’d say it’s pretty safe. Overall a perfect toy for dogs, with a squeaker and nice textures for the dog to chew on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
J
Verified Purchase
jjv
Chelsea, US
★★★★★ 5
Fun for a dog bad from lamb chop.
Style: Lambchop, Size: 10" (Pack of 2)
My dog loves these but tears the stffing out in one day. Not a bad product just be aware of this fact. Dog is a pit bull terrier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
J
Verified Purchase
JMM
Dallas, US
★★★★★ 5
Adorable dog toy!
Style: Lambchop, Size: 10"
This is a fabulous dog toy, purchased on a sale - great price point. Item is larger than expected, worth the purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
Adarius Carr Prime
Carnegie, US
★★★★★ 5
Great value for the price
Style: White, Size: 24" Jumbo
I have gotten smaller versions of this Lamb chop, my dog has loved them all the same but this one is great. It's big enough for him to carry around and it lasts a lot longer since he likes to tear them up fast.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
L
Verified Purchase
Literally doesn’t work
Bozeman, US
★★★★★ 5
Great Value Toy
Color: Crinkle Duck (Blue), Size: Large, Color: Crinkle Duck (Blue), Size: Large
This toy has been one of my dog’s absolute favorites. He gets excited every time he sees it and will carry it around the house, toss it in the air, and keep himself entertained for a long time. The shape and texture seem perfect for him, and it quickly became one of his go-to toys over everything else in his basket. What I really like is that it holds up reasonably well for the price. It’s definitely not indestructible, and after a lot of play, it will sometimes start to rip—usually around the feet first since that’s where my dog tends to grab and chew the most. But honestly, considering how affordable it is, I don’t mind replacing it when needed. It’s inexpensive enough that rebuying feels worth it because he genuinely loves it that much. I’d rather keep buying a toy he is obsessed with than spend more on something that just sits untouched. It’s fun, cute, and keeps him happy, which is what matters most. Overall, I’d definitely recommend it for dogs who love plush toys and playful chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026

recommand products