SKU: 73139661219

Human TL1A/TNFSF15 Protein, hFc Tag

$180.00 $200.00
Save 10%
No.2 Bestseller on 2pierres.com >

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TL1A/TNFSF15 Protein, hFc TagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI Accession O95150 1 Amino Acid Sequence Protein sequence (O95150 1, Leu72 Leu251, with N hFc Tag)

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI
Accession O95150-1
Amino Acid Sequence

Protein sequence (O95150-1, Leu72-Leu251, with N-hFc Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Expression System HEK293
Molecular Weight Predicted MW: 47.4 kDa Observed MW: 45-55 kDa
Purity ＞90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73139661219

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeff S.
Draper, US
★★★★★ 5
Excellent mineral sunscreen for sensitive skin.
Set name: Tube - 3 oz.
I’ve been using the Blue Lizard Sensitive Mineral Sunscreen, and it’s become a staple in my routine. As someone with sensitive skin, I really appreciate that it’s fragrance-free and uses zinc oxide, providing great protection without causing any irritation or breakouts. It goes on smoothly, isn't overly greasy, and the water resistance holds up well for outdoor activities. The smart cap technology is a nice touch, too. Highly recommended if you’re looking for effective, non-irritating sun protection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
P
Verified Purchase
Public Service Announcement
Grantham, US
★★★★★ 5
No chemicals that will be harmful!
Set name: Tube - 5 oz. 2-Pack
Ordered this mineral sunscreen looking for something simple and effective, and it’s been a solid option so far. The zinc oxide formula is the main reason I went with it. It doesn’t rely on the same chemical ingredients found in a lot of other sunscreens, which is a big plus if you’re trying to avoid that. It feels like a cleaner option overall. Coverage is good. It spreads evenly and holds up well, even with some water exposure. I’ve used it outdoors for extended periods, and it does its job without needing constant reapplication. It does leave a slight white cast at first, which is pretty typical with mineral sunscreens, but it fades in as you rub it in. Not completely invisible, but manageable. After a few uses, what stood out most is that it doesn’t have a strong smell and doesn’t irritate the skin. It just works without a lot of extras. Compared to standard chemical sunscreens, this feels more straightforward and less harsh, especially for regular use. For the price, it’s a great value. You’re getting strong sun protection without the added ingredients some people try to avoid. If you’re looking for a mineral-based sunscreen that’s effective and a bit cleaner in formulation, this is a solid choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
A
Verified Purchase
AZ since '03
Draper, US
★★★★★ 5
Great mineral sunscreen that actually works
Set name: Tube - 5 oz.
Blue Lizard Sensitive Mineral SPF 50 has become my daily go-to. It goes on smooth, doesn’t leave a weird white cast like some mineral sunscreens, and gives solid protection. I like that it’s 100% mineral with no harsh chemicals and has organic aloe vera in it, so my skin feels hydrated instead of dried out. No greasy feeling, no strong scent, and it holds up well even when I sweat a bit. Been using it for a few weeks now and it performs exactly how I want. Small bottle but a little goes a long way. Definitely recommend if you want a simple, effective mineral option.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
H
Verified Purchase
HyeYoung Cho
Draper, US
★★★★★ 5
Gentle, hydrating with a slight white cast
Set name: Tube - 5 oz.
Really solid mineral sunscreen. Goes on smooth, not too thick, and feels lightweight but still hydrating. It does leave a slight white cast, which I actually like since it feels like better protection. The formula feels gentle and doesn’t irritate my skin. Great for daily use, and the UV color-changing cap is a nice bonus. Would repurchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
M
Verified Purchase
Mlnkjns
New York, US
★★★★★ 4
Great sunblock.
Set name: Stick - 0.5 oz.
Love this stuff. It’s the only sunscreen that doesn’t sting my eyes. It works really well. It goes a long way. Lil dab will do ya. Maybe I use too much each application. I live in Florida and put it on my arms and face everyday. It does leave white smudges, smears and handprints on things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products

Jayemdae Tome [Summer Magic / Edgar]
1456.90
Ornithopter [Summer Magic / Edgar]
262.50
Ivory Cup [Summer Magic / Edgar]
210.00
Deadly Rollick [Commander 2020]
22.80
Kormus Bell [Summer Magic / Edgar]
26.30